IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. Cancer Cell (1535-6108) 2012 imex curation Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk Accepted 2013-FEB-05 by PPORRAS 01-March-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. Cancer Cell (1535-6108) 2012 imex curation Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions human-prostate_carcinoma Homo sapiens prostate carcinoma prostate_carcinoma Prostate carcinoma (cancer) ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk Accepted 2013-FEB-05 by PPORRAS 01-March-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. Cancer Cell (1535-6108) 2012 imex curation Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions human-prostate_carcinoma Homo sapiens prostate carcinoma prostate_carcinoma Prostate carcinoma (cancer) ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk Accepted 2013-FEB-05 by PPORRAS 01-March-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. Cancer Cell (1535-6108) 2012 imex curation Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions human-prostate tissue Homo sapiens prostate prostate ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk Accepted 2013-FEB-05 by PPORRAS 01-March-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. The Androgen Receptor Induces a Distinct Transcriptional Program in Castration-Resistant Prostate Cancer in Man. Cancer Cell (1535-6108) 2012 imex curation Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sharma N.L., Massie C.E., Ramos-Montoya A., Zecchini V., Scott H.E., Lamb A.D., Macarthur S., Stark R., Warren A.Y., Mills I.G., Neal D.E. Cancer - Interactions investigated in the context of cancer CRPC tissue -Castration Resistant Prostate Carcinoma Interactions involving histones have not been included due to lack of antibody target specificity. Interactions involving "STAT5" have not been included as the identity of the molecule(s) is not known. den22@medschl.cam.ac.uk Accepted 2013-FEB-05 by PPORRAS 01-March-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation klk3_human_gene Human kallikrein-related peptidase 3 (KLK3) (PSA) gene gene human Homo sapiens Human kkcc2_human_gene KKCC2_HUMAN_GENE gene gene human Homo sapiens Human foxa1_human Hepatocyte nuclear factor 3-alpha FOXA1 HNF3A TCF3A Forkhead box protein A1 Transcription factor 3A protein protein human Homo sapiens Human MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS DIP protein P55317 original sequence version: 116 B2489523459EEB4C fkbp5_human_gene Human FKBP5 gene gene gene human Homo sapiens Human pepc_human_gene PEPC_HUMAN_HUMAN gene gene human Homo sapiens Human tyw2_human_gene TYW2_HUMAN_GENE/TRMT12 gene gene human Homo sapiens Human ei2be_human_gene EI2BE_HUMAN_GENE gene gene human Homo sapiens Human andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ DIP protein P10275 original sequence version: 220 DIP protein P10275-1 original sequence version: 213 DIP protein P10275 original sequence version: 216 DIP protein P10275 original sequence version: 143 DIP protein P10275 original sequence version: 174 DIP protein P10275 original sequence version: 169 DIP protein P10275 original sequence version: 188 DIP protein P10275-1 original sequence version: 188 DIP protein P10275 original sequence version: 196 DIP protein P10275 original sequence version: 217 DIP protein P10275-1 original sequence version: 217 DIP protein P10275-1 original sequence version: 207 A73432C55D39AE06 tmps2_human_gene Human TMPS2/TMPRSS2 gene gene gene human Homo sapiens Human ar-fkbp5-1 3 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association 1A ar-fkbp5-2 3 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association 1A ar-klk3-1 3 13 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association 1A ar-fkbp5-3 3 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association 1A ar-klk3-1 3 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association 1A ar-fkbp5-4 1 13 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey association association 1D ar-fkbp5-4 1 13 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey association association 1B ar-fkbp5-5 2 13 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey association association 1D ar-fkbp5-5 2 13 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey association association 1B ar-klk3-1 2 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association 1E ar-fkbp5-6 4 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association 1B ar-foxa1-1 5 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 6D An attenuated AR-FOXA1 interaction was seen in in xenografts, in comparison with cultured cells, and also a gain of AR-STAT5 interaction in xenografts. ar-tyw2-1 2 13 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association 8A