IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. Cancer Cell (1535-6108) 2012 imex curation Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-dnd-41 Human DND-41 (T-ALL; type III cortical) cell line dnd-41 Human DND-41 (T-ALL; type III cortical) cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer For the tcr-a (T cell Receptor alpha) enhancer I dont think it is possible to add an Ensembl ID as a gene X-Ref (do feel free to find the right one...!) - so have entered this as "DNA" rather than as a "gene". "The TCRα enhancer (Eα) located at the 3′ end of the TCRα/δ locus functions over a long chromosomal distance to promote TCRα rearrangement" (so the relevant stretch of DNA is no-where near any gene - as found on blatting...) The DNA primer sequences for ChIP could/would include the EMSA probe sequence - but I have no idea how the 2 stretches of DNA (primers and probe) correspond... TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Accepted 2012-MAY-14 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. Cancer Cell (1535-6108) 2012 imex curation Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-t-all Human-T-cell acute lymphoblastic leukemia cells t-cell_acute_lymphoblastic_leukemia T-cell acute lymphoblastic leukemia cell (T-ALL) confocal microscopy confocal microscopy immunostaining immunostaining Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Accepted 2012-MAY-14 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. Cancer Cell (1535-6108) 2012 imex curation Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-all-sil Human ALL-SIL -a T-ALL (T cell acute lymphoblastic leukemia) cell line all-sil ALL-SIL -Human T-ALL (T cell acute lymphoblastic leukemia) cell line carries NUP214-ABL1 fusion gene ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer For the tcr-a (T cell Receptor alpha) enhancer I dont think it is possible to add an Ensembl ID as a gene X-Ref (do feel free to find the right one...!) - so have entered this as "DNA" rather than as a "gene". "The TCRα enhancer (Eα) located at the 3′ end of the TCRα/δ locus functions over a long chromosomal distance to promote TCRα rearrangement" (so the relevant stretch of DNA is no-where near any gene - as found on blatting...) The DNA primer sequences for ChIP could/would include the EMSA probe sequence - but I have no idea how the 2 stretches of DNA (primers and probe) correspond... TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Accepted 2012-MAY-14 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. Cancer Cell (1535-6108) 2012 imex curation Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-all-sil Human ALL-SIL -a T-ALL (T cell acute lymphoblastic leukemia) cell line all-sil ALL-SIL -Human T-ALL (T cell acute lymphoblastic leukemia) cell line carries NUP214-ABL1 fusion gene confocal microscopy confocal microscopy immunostaining immunostaining Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Accepted 2012-MAY-14 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. Cancer Cell (1535-6108) 2012 imex curation Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-t-all Human-T-cell acute lymphoblastic leukemia cells t-cell_acute_lymphoblastic_leukemia T-cell acute lymphoblastic leukemia cell (T-ALL) confocal microscopy confocal microscopy immunostaining immunostaining Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Accepted 2012-MAY-14 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. Cancer Cell (1535-6108) 2012 imex curation Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Accepted 2012-MAY-14 by ORCHARD Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. Cancer Cell (1535-6108) 2012 imex curation Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Accepted 2012-MAY-14 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. Cancer Cell (1535-6108) 2012 imex curation Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-dnd-41 Human DND-41 (T-ALL; type III cortical) cell line dnd-41 Human DND-41 (T-ALL; type III cortical) cell line confocal microscopy confocal microscopy immunostaining immunostaining Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Accepted 2012-MAY-14 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. Cancer Cell (1535-6108) 2012 imex curation Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-all-sil Human ALL-SIL -a T-ALL (T cell acute lymphoblastic leukemia) cell line all-sil ALL-SIL -Human T-ALL (T cell acute lymphoblastic leukemia) cell line carries NUP214-ABL1 fusion gene anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Accepted 2012-MAY-14 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. Cancer Cell (1535-6108) 2012 imex curation Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down anti tag western anti tag western blot anti tag western Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Accepted 2012-MAY-14 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. Cancer Cell (1535-6108) 2012 imex curation Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-dnd-41 Human DND-41 (T-ALL; type III cortical) cell line dnd-41 Human DND-41 (T-ALL; type III cortical) cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Accepted 2012-MAY-14 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation ets1a_chick Transforming protein p54/c-ets-1 ETS1 protein protein chick Gallus gallus (Chicken) Chicken MKAAVDLKPTLTIIKTEKVDIDLFPSPDMECADVPLLTPSSKEMMSQALKATFSGFAKEQQRLGIPKDPQQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKECFLELRPDFVGDILWEHLEILQKEEAKPYPANGVNAAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPVQTDSLQTDYFTIKQEVVTPDNMCMGRASRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFQSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADMNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE 5CF3C575CCE115F5 ets1_mouse Protein C-ets-1 Ets1 Ets-1 p54 protein protein mouse Mus musculus Mouse MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVKPYQVNGANPTYPESCYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILQDPLQTDTLQTDYFAIKQEVLTPDNMCLGRASRGKLGGQDSFESVESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDYEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD DIP protein P27577 original sequence version: 126 151164D83C41B143 tca-alpha_enhancer_ebs E-alpha core element containing ETS1 and RUNX1 binding sites dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human TCTCCCGCAGAAGCCACATCCTCTGGAAAGA ets1_human Protein C-ets-1 p54 ETS1 EWSR2 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE DIP protein P14921 original sequence version: 175 3B66BCC464B393FB tlx3_human T-cell leukemia homeobox protein 3 TLX3 HOX11L2 Homeobox protein Hox-11L2 protein protein human Homo sapiens Human MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLPASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV B5E3B910393EB4F3 tlx1_human T-cell leukemia homeobox protein 1 TLX1 HOX11 TCL3 Homeobox protein Hox-11 Proto-oncogene TCL-3 T-cell leukemia/lymphoma protein 3 protein protein human Homo sapiens Human MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGGGSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRILLQLQQEAFQKSLAQPLPADPLCVHNSSLFALQNLQPWSDDSTKITSVTSVASACE 09A518FB5271F7ED tlx2_human T-cell leukemia homeobox protein 2 TLX2 HOX11L1 NCX Homeobox protein Hox-11L1 Neural crest homeobox protein protein protein human Homo sapiens Human MEPGMLGPHNLPHHEPISFGIDQILSGPETPGGGLGLGRGGQGHGENGAFSGGYHGASGYGPAGSLAPLPGSSGVGPGGVIRVPAHRPLPVPPPAGGAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV 794B07A9E7817939 tcr-alpha_enhancer T Cell Receptor-Alpha_Enhancer dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GGCGGTCCCCTCCCATTTCCATGACGTCATGGTTACCAAGAGGGGCAAGTAGGGCACCCTTTGAAGCTCTCCCGCAGAAGCCACATCCTCTGGAAAGA Sequence given is from the Human TCR-alpha minimal enhancer - Giese at al, Genes and Development. 1995. tlx1-ets1 6 13 unspecified role unspecified role prey prey ets_dna_binding_domain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 17 unspecified role unspecified role bait bait homeodomain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 22 25 direct interaction direct interaction Fig 3A tlx3-ets1 6 13 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ets_dna_binding_domain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range in vitro In vitro 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined homeodomain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range ecoli Escherichia coli (strain K12) 33 30 direct interaction direct interaction Fig 3A tlx1-ets1-1 10 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sbp sbp undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 3B tlx3-ets1-2 10 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait region sbp sbp undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 3B tlx1-ets1-2 9 15 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig 3C tlx3-ets1-4 11 15 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association Fig 3C ets1-tlx1 4 17 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 4C/D ets1-tlx1-1 2 17 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 4C ets1-tlx3 8 16 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 4C ets1-tlx3-1 5 15 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 4C tca_alpha-ets1 7 14 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig 5A/B The addition of TLX1 (lanes 2–4) or TLX3 (lanes 5–7) to ETS1 and EBS produced a dose-dependent "super-shifted" complex. tca_alpha-ets1-2 7 14 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role ancillary ancillary physical association physical association Fig 5A/B The addition of TLX1 (lanes 2–4) or TLX3 (lanes 5–7) to ETS1 and EBS produced a dose-dependent "super-shifted" complex. tca_alpha-ets1-3 7 18 unspecified role unspecified role ancillary ancillary 12 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 5A/B The addition of TLX1 (lanes 2–4) or TLX3 (lanes 5–7) to ETS1 and EBS produced a dose-dependent "super-shifted" complex. ets1-tcr_alpha 3 15 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey association association Fig 5 C/D Knockdown of ETS1 reduced Eα-binding by both ETS1 and TLX1/TLX3. tlx3-tcr_alpha-1 1 19 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association Fig 5 C/D Knockdown of ETS1 reduced Eα-binding by both ETS1 and TLX1/TLX3. tx1-tcr_alpha 3 19 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig 5 C/D Knockdown of ETS1 reduced Eα-binding by both ETS1 and TLX1/TLX3. ets1-tcr_alpha 1 15 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey association association Fig 5 C/D Knockdown of ETS1 reduced Eα-binding by both ETS1 and TLX1/TLX3.