IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-synovial_sarcoma Homo sapiens synovial_sarcoma synovial_sarcoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-synovial_sarcoma mouse synovial sarcoma synovial_sarcoma synovial_sarcoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-ccl-153 Human CCL-153, human fetal lung fibroblast cell line (normal) ccl-153 human fetal lung fibroblast cell line (normal) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-synovial_sarcoma Homo sapiens synovial_sarcoma synovial_sarcoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. emsa supershift electrophoretic mobility supershift assay emsa supershift tag visualisation tag visualisation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-syo-1 Human SYO-1 Synovial sarcoma cell line syo-1 Human SYO-1 Synovial sarcoma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-syo-1 Human SYO-1 Synovial sarcoma cell line syo-1 Human SYO-1 Synovial sarcoma cell line emsa supershift electrophoretic mobility supershift assay emsa supershift tag visualisation tag visualisation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. entered as "anti-tab WB" as stated to be "reciprocal" IP assay -presumably of Fig 3C (Expt-6) - which uses anti-myc ab for IP. (no indication otherwise given for Participant detection.) Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-syo-1 Human SYO-1 Synovial sarcoma cell line syo-1 Human SYO-1 Synovial sarcoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-synovial_sarcoma mouse synovial sarcoma synovial_sarcoma synovial_sarcoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-syo-1 Human SYO-1 Synovial sarcoma cell line syo-1 Human SYO-1 Synovial sarcoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-syo-1 Human SYO-1 Synovial sarcoma cell line syo-1 Human SYO-1 Synovial sarcoma cell line density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Deconstruction of the SS18-SSX Fusion Oncoprotein Complex: Insights into Disease Etiology and Therapeutics. Cancer Cell (1535-6108) 2012 imex curation Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-fuji FUJI -Human Synovial Sarcoma cell line expressing SYT-SSX2 fusion protein. fuji FUJI -Human Synovial Sarcoma cell line expressing SYT-SSX2 fusion protein. human synovial sarcoma cell line=fusion transcript, Fuji cells = SYT-SSX2. Ref =Nojima,T. et al;. (1990) Acta Pathol. Jap., 40, 487- =PMID: 2171298 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su L., Sampaio A.V., Jones K.B., Pacheco M., Goytain A., Lin S., Poulin N., Yi L., Rossi F.M., Kast J., Capecchi M.R., Underhill T.M., Nielsen T.O. Cancer - Interactions investigated in the context of cancer The antibody "RA2009" can detect both SS18-SSX1 and SS18-SSX2 fusion proteins. However the cell lines used produce only one of these two fusion proteins, so there is unlikely to be any ambiguity in participant identity. Glycerol-Gradient Sedimentations were carried out using Nuclear fractions of cell lines. The fusion protein "SS18-SSX2" has been entered as Trembl entry A4PIW0 and "SS18-SSX1" as A4PIV8. These are reference entries only and may not be an exact match to the sequences of proteins mentioned in this publication. tunderhi@brc.ubc.ca Accepted 2012-MAY-02 by PPORRAS 20-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation cd2a2_human_gene Cyclin-dependent kinase inhibitor 2A- CDKN2A gene gene human Homo sapiens Human hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA a4piv8_human SYT-SSX1 protein protein human Homo sapiens Human MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE B17F952CE3F673AA atf2_mouse Cyclic AMP-dependent transcription factor ATF-2 Atf2 Activating transcription factor 2 cAMP response element-binding protein CRE-BP1 MXBP protein protein protein mouse Mus musculus Mouse MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPPSQAQPSGS F9CDEC3BC3119ACB nupr1_mouse_gene Nuclear protein 1 gene gene mouse Mus musculus Mouse suz12_human Polycomb protein SUZ12 CHET9 JJAZ1 KIAA0160 SUZ12 Suppressor of zeste 12 protein homolog Joined to JAZF1 protein Chromatin precipitated E2F target 9 protein protein protein human Homo sapiens Human MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL DIP protein Q15022 original sequence version: 92 DIP protein Q15022 original sequence version: 88 DIP protein Q15022 original sequence version: 91 DIP protein Q15022 original sequence version: 106 A8830EBC3FD38D56 atf3_human_gene cAMP-dependent transcription factor ATF-3 gene gene human Homo sapiens Human cre_oligo_probe consensus CRE (cAMP-responsive element) site probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) AGAGATTGCCTGACGTCAGAGAGCTAG ezh2_mouse Histone-lysine N-methyltransferase EZH2 Ezh2 Enx1h Enhancer of zeste homolog 2 ENX-1 protein protein mouse Mus musculus Mouse MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPPRKFPADKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP 7442C751E13EA24B egr1_mouse_gene Mouse EGR1 gene gene gene mouse Mus musculus Mouse atf3_mouse_gene Mouse ATF3 gene gene gene mouse Mus musculus Mouse smca2_human Probable global transcription activator SNF2L2 ATP-dependent helicase SMARCA2 SNF2-alpha SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 SMARCA2 BRM SNF2A SNF2L2 BAF190B Protein brahma homolog BRG1-associated factor 190B protein protein human Homo sapiens Human MSTPTDPGAMPHPGPSPGPGPSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVSHPMPTMGSTDFPQEGMHQMHKPIDGIHDKGIVEDIHCGSMKGTGMRPPHPGMGPPQSPMDQHSQGYMSPHPSPLGAPEHVSSPMSGGGPTPPQMPPSQPGALIPGDPQAMSQPNRGPSPFSPVQLHQLRAQILAYKMLARGQPLPETLQLAVQGKRTLPGLQQQQQQQQQQQQQQQQQQQQQQQPQQQPPQPQTQQQQQPALVNYNRPSGPGPELSGPSTPQKLPVPAPGGRPSPAPPAAAQPPAAAVPGPSVPQPAPGQPSPVLQLQQKQSRISPIQKPQGLDPVEILQEREYRLQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVWEHKQAQAAKEKKKRRRRKKKAEENAEGGESALGPDGEPIDESSQMSDLPVKVTHTETGKVLFGPEAPKASQLDAWLEMNPGYEVAPRSDSEESDSDYEEEDEEEESSRQETEEKILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPAKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNEEEEEEDEEESESEAKSVKVKIKLNKKDDKGRDKGKGKKRPNRGKAKPVVSDFDSDEEQDEREQSEGSGTDDE DIP protein P51531 original sequence version: 66 DIP protein P51531 original sequence version: 126 CE69BBB287D35AB5 dus1_human_gene Dual specificity protein phosphatase 1 gene gene human Homo sapiens Human a4piw0_human SYT-SSX2 protein protein human Homo sapiens Human MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEKIHERSGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE ED4D19E02B995BBB atf2_human Cyclic AMP-dependent transcription factor ATF-2 ATF2 CREB2 CREBP1 Activating transcription factor 2 cAMP response element-binding protein CRE-BP1 HB16 Cyclic AMP-responsive element-binding protein 2 protein protein human Homo sapiens Human MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPSSQSQPSGS 0190EEFAEC8891A7 eed_human Polycomb protein EED EED WD protein associating with integrin cytoplasmic tails 1 Embryonic ectoderm development protein protein protein human Homo sapiens Human MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR DIP protein O75530 original sequence version: 70 DIP protein O75530-1 original sequence version: 78 DIP protein O75530 original sequence version: 78 DIP protein O75530 original sequence version: 73 DIP protein O75530-1 original sequence version: 89 DIP protein O75530-1 original sequence version: 87 DIP protein O75530 original sequence version: 77 D2E0A5BA27C0499A tle1_human Transducin-like enhancer protein 1 TLE1 Enhancer of split groucho-like protein 1 E(Sp1) homolog protein protein human Homo sapiens Human MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIKDDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSDGDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVGFDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY DIP protein Q04724 original sequence version: 119 695FD1A37410EFE5 fos_human_gene Human FOS gene gene gene human Homo sapiens Human meis2_mouse_gene MEIS2_MOUSE gene gene mouse Mus musculus Mouse meis2_human_gene Human MEIS2 gene gene gene human Homo sapiens Human dus1_mouse_gene Dual specificity protein phosphatase 1 gene gene mouse Mus musculus Mouse ssxt_human Protein SSXT SS18 SSXT SYT Synovial sarcoma translocated to X chromosome protein Protein SYT protein protein human Homo sapiens Human MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ 7E089D557538252F fos_mouse_gene Mouse FOS gene gene gene mouse Mus musculus Mouse nupr1_human_gene Human NUPR1 gene gene gene human Homo sapiens Human ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP DIP protein Q15910 original sequence version: 97 DIP protein Q15910 original sequence version: 94 DIP protein Q15910 original sequence version: 92 DIP protein Q15910 original sequence version: 96 DIP protein Q15910 original sequence version: 122 DIP protein Q15910 original sequence version: 100 1B5029EB9D509BE5 cd2a2_mouse_gene Cyclin-dependent kinase inhibitor 2A gene gene mouse Mus musculus Mouse tle1_mouse Transducin-like enhancer protein 1 Groucho-related protein 1 Tle1 Grg1 protein protein mouse Mus musculus Mouse MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSASLLALSSALSGQSHLAIKDDKKHHDAERHRDRESGTSNSLLVPDSLRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVVDVSNEDPSSPHASPTHSPRENGIDKNRLLKKDASGSPASTASSGSSSSLKSKEVSLHEKANTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAMEPLVNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYAGLHSMSPQMSAAAAAAAAAVVAYGRSPMVGFDPPPHMRVPSIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY 65803C8F39BB0703 smca5_human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 SMARCA5 SNF2H WCRF135 Sucrose nonfermenting protein 2 homolog protein protein human Homo sapiens Human MSSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTESSVYNFEGEDYREKQKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILFYRKTIGYKVPRNPELPNAAQAQKEEQLKIDEAESLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMELEEKEKAEKKKRGPKPSTQKRKMDGAPDGRGRKKKLKL DIP protein O60264 original sequence version: 127 DIP protein O60264 original sequence version: 153 6CC8CB25BAF7A876 egr1_human_gene Early growth response 1 Human gene gene gene human Homo sapiens Human hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein O09106 original sequence version: 147 DIP protein O09106 original sequence version: 87 DIP protein O09106 original sequence version: 131 DIP protein O09106 original sequence version: 119 DIP protein O09106 original sequence version: 106 DIP protein O09106 original sequence version: 144 DIP protein O09106 original sequence version: 146 DIP protein O09106 original sequence version: 161 DIP protein O09106 original sequence version: 167 DIP protein O09106 original sequence version: 169 DIP protein O09106 original sequence version: 124 DIP protein O09106 original sequence version: 134 DIP protein O09106 original sequence version: 103 DIP protein O09106 original sequence version: 122 7F64D3C17F5E4844 syt_ssx2-atf2-10 14 29 unspecified role unspecified role prey prey 45 unspecified role unspecified role prey prey 32 unspecified role unspecified role prey prey 34 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait 33 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey 42 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey association association Fig 1A, S1C. ssxt_ssx2--atf2 1 31 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey 34 unspecified role unspecified role prey prey association association Fig 1C syt_ssx1-atf2 1 20 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey 34 unspecified role unspecified role prey prey association association Fig 1C ssxt_ssx2_hum-atf2-4 2 21 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait association association Fig 1C syt_ssx2-atf2-1 1 32 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey association association Fig 1C tle1-atf2 1 34 unspecified role unspecified role prey prey 31 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait association association Fig 1C syt_ssx1-atf2-1 1 20 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey association association Fig 1C tle1-atf2-1 1 20 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey association association Fig 1C ssxt_ssx2_hum-atf2-5 15 29 unspecified role unspecified role neutral component neutral component 31 unspecified role unspecified role neutral component neutral component 34 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 42 unspecified role unspecified role neutral component neutral component 32 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 1D, S1G, 3D, 8D. ATF2 and TLE1 migrate as individual glycerol-gradient peaks in SS18-SSX2-knockdown cells. HDAC inhibitor, Romidepsin. SS18-SSX2 and TLE1 are located in two separate elution peaks after Romidepsin treatment. syt_ssx2-atf2-2 11 34 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey 32 unspecified role unspecified role prey prey association association Fig 3A ATF2 and TLE1 coimmunoprecipitation is dependent upon SS18-SSX2. atf2-syt_ssx2-2 11 32 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey 31 unspecified role unspecified role prey prey association association Fig 3A ATF2 and TLE1 coimmunoprecipitation is dependent upon SS18-SSX2. atf2-syt_ssx2-1 11 32 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey association association Fig 1B, 3B. Recruitment of ATF2 and TLE1 to SS18-SSX2 seems to be independent of each other. syt_ssx2-tle1 11 31 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey association association Fig 3B Recruitment of ATF2 and TLE1 to SS18-SSX2 seems to be independent of each other. syt_ssx2-atf2-4 11 31 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey association association Fig 3B Recruitment of ATF2 and TLE1 to SS18-SSX2 seems to be independent of each other. syt_ssx2-atf2-5 9 32 unspecified role unspecified role prey prey atf2 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role prey prey tle1 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region_including_snh_domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ssxrd_domain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range 114 119 116 120 association association Fig 3C, 3F. Results suggest that the N-terminal SNH (SYT N-terminal homolog) domain is responsible for the interaction of SS18-SSX2 with ATF2, whereas TLE1 specifically interacts with the repressor domain (SSXRD) of SS18-SSX2. syt_ssx2-atf2-6 9 39 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 32 unspecified role unspecified role prey prey physical association physical association Fig 3C tle1-atf2 9 34 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey 31 unspecified role unspecified role prey prey ssxrd_domain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 3F. Results suggest that the N-terminal SNH (SYT N-terminal homolog) domain is responsible for the interaction of SS18-SSX2 with ATF2, whereas TLE1 specifically interacts with the repressor domain (SSXRD) of SS18-SSX2. ATF2 does not bind to TLE1 in the absence of the SNH domain of SS18-SSX2. atf2-tle1 9 31 unspecified role unspecified role prey prey region_including_snh_domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 32 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey association association Fig 3F. Results suggest that the N-terminal SNH (SYT N-terminal homolog) domain is responsible for the interaction of SS18-SSX2 with ATF2, whereas TLE1 specifically interacts with the repressor domain (SSXRD) of SS18-SSX2. TLE1 does not bind to ATF2 in the absence of the SSSRD domain of SS18-SSX2. atf2-egr1 4 32 unspecified role unspecified role bait bait 46 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 4A, 5B/C. tle1-egr1-1 4 46 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association Fig 4A, 5B/C. ssx2-egr1 4 31 unspecified role unspecified role prey prey 46 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 4A, 5C. egr1-syt_ssx1 4 46 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role prey prey association association Fig 5B. atf3-syt_ssx1 4 24 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role prey prey association association Fig 5B cdnk2a-syt_ssx1 4 17 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role prey prey association association Fig 5B. atf2-cdnk2a 4 32 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5B/C. atf2-atf3 4 24 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 32 unspecified role unspecified role bait bait association association Fig 5B/C. atf2-dusp1 4 32 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5B/C. tle1-dusp1 4 30 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association Fig 5B/C. atf3-syt_ssx2 4 31 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5C syt_ssx1-dusp1 4 20 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5B. cdnk2a-syt_ssx2-2 4 31 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5C. syt_ssx2-dus1 4 30 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Fig 5C. tle1-atf3 4 24 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association Fig 5B/C. tle1-cdnk2a 4 17 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association Fig 5B/C. cre-syt_ssx2 5 25 unspecified role unspecified role bait bait 5-prime_infrared_dye_700 tag tag certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 31 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 5D cre-atf2 7 25 unspecified role unspecified role bait bait 5-prime_infrared_dye_700 tag tag certain certain sequence position certain certain certain sequence position certain 31 unspecified role unspecified role prey prey association association Fig 5E tle1-egr1-2 6 46 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association Fig 6A, 7A, S7G. Results from HDAC inhibitor-treated SYO-1 cells show the removal of TLE1 from target promoters, whereas SS18-SSX2 and ATF2 remain resident. HDAC inhibitors Romidepsin and SB939. atf2-atf3-1 6 32 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A, 7A, S7G. syt_ssx2-dus1-1 6 30 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Fig 6A atf3-syt_ssx2-1 6 31 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A,7A, S7G. atf2-dusp1-1 6 32 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A atf2-cdnk2a-1 6 17 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 32 unspecified role unspecified role bait bait association association Fig 6A tle1-cdnk2a-1 6 34 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A cdnk2a-syt_ssx2-3 6 31 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A atf2-egr1-1 6 32 unspecified role unspecified role bait bait 46 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A, 7A, S7G. ssx2-egr1-1 6 31 unspecified role unspecified role prey prey 46 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A, 7A, S7G. tle1-dusp1-1 6 34 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A tle1-atf3-1 6 34 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A,7A, S7G. Results from HDAC inhibitor-treated SYO-1 cells show the removal of TLE1 from target promoters, whereas SS18-SSX2 and ATF2 remain resident. HDAC inhibitors Romidepsin and SB939. atf2-nupr1 6 41 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 32 unspecified role unspecified role bait bait association association Fig 6A tle1-nupr1-1 6 34 unspecified role unspecified role bait bait 41 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A tle1-meis2 6 37 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association Fig 6A atf2-meis2-1 6 32 unspecified role unspecified role bait bait 37 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A atf2-fos 6 32 unspecified role unspecified role bait bait 35 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A tle1-fos 6 35 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association Fig 6A syt_ssx2-nupr1 6 31 unspecified role unspecified role bait bait 41 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A syt_ssx2-meiss2 6 37 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Fig 6A syt_ssx2-fos 6 35 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Fig 6A syt_ssx2-egr1 12 27 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Fig 6C, 8E. HDAC inhibitors, Romidepsin and SB939. syt_ssx2-atf3 12 28 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Fig 6C, 8E. HDAC inhibitors, Romidepsin and SB939. atf2-atf3 12 21 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6C, 8E. HDAC inhibitors, Romidepsin and SB939. tle1-atf3-2 12 28 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 44 unspecified role unspecified role bait bait association association Fig 6C, 8E. HDAC inhibitors, Romidepsin and SB939. atf2-egr1-1 12 27 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role bait bait association association Fig 6C, 8E. HDAC inhibitors, Romidepsin and SB939. tle1-egr1-2 12 44 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6C, 8E. HDAC inhibitors, Romidepsin and SB939. syt_ssx2-atf2-8 11 34 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 42 unspecified role unspecified role prey prey 32 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait association association Fig 7D, 8C. EZH2 ( and HDAC1) interactions are maintained in the absence of ATF2 but require TLE1. HDAC inhibitors Romidepsin, SB939. egr1-hdac1 6 46 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role bait bait association association Fig 7E, 8B. Depletion of TLE1 is associated with a concomitant decrease in HDAC1 and EZH2 occupancy on both EGR1 and ATF3 target promoter regions. HDAC inhibitors Romidepsin, SB939. atf3-hdac1 6 24 acceptor acceptor prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 acceptor acceptor bait bait association association Depletion of TLE1 is associated with a concomitant decrease in HDAC1 and EZH2 occupancy on both EGR1 and ATF3 target promoter regions. Fig 7E, 8B. HDAC inhibitors Romidepsin, SB939. ezh2-atf3 6 24 acceptor acceptor prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 42 acceptor acceptor bait bait association association Depletion of TLE1 is associated with a concomitant decrease in HDAC1 and EZH2 occupancy on both EGR1 and ATF3 target promoter regions. Fig 7E, 8B. HDAC inhibitors Romidepsin, SB939. ezh2-egr1 6 42 unspecified role unspecified role bait bait 46 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Depletion of TLE1 is associated with a concomitant decrease in HDAC1 and EZH2 occupancy on both EGR1 and ATF3 target promoter regions. Fig 7E, 8B. HDAC inhibitors Romidepsin, SB939. tle1-hdac1 3 42 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait association association Fig 7F hdac1-ezh2 3 42 unspecified role unspecified role prey prey 34 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association Fig 7F ezh2-hdac1 3 18 unspecified role unspecified role prey prey 34 unspecified role unspecified role prey prey 42 unspecified role unspecified role bait bait association association Fig 7F tle1-hdac1-1 8 47 unspecified role unspecified role prey prey 44 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey association association Fig 7F tle1-ezh2 8 47 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait 44 unspecified role unspecified role prey prey association association Fig 7F ezh2-hdac1-2 8 47 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey association association Fig 7F hdac1-atf3-1 12 28 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 47 unspecified role unspecified role bait bait association association Fig 7G, 8E. HDAC inhibitors, Romidepsin and SB939. ezh2-atf3 12 28 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role bait bait association association Fig 7G, 8E. HDAC inhibitors, Romidepsin and SB939. hdac1-egr1 12 47 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 7G, 8E. HDAC inhibitors, Romidepsin and SB939. ezh2-egr1 12 26 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 7G, 8E. HDAC inhibitors, Romidepsin and SB939. syt_ssx2-atf2-9 2 31 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey 47 unspecified role unspecified role prey prey association association Fig 7H. syt_ssx1-atf2-2 16 34 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey association association Fig S1D ss18-atf2 10 39 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 32 unspecified role unspecified role bait bait association association Fig S3B Tle1 is not precipitated in the absence of the SS18-SSX fusion protein. syt_ssx1-atf2-3 10 34 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S3C atf2-syt_ssx1 10 32 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S3C ssxt_ssx2_hum-atf2-6 13 34 unspecified role unspecified role neutral component neutral component 31 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 32 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig S3D ATF2 and TLE1 migrate as individual glycerol-gradient peaks in the absence of (myc)-SS18-SSX2. syt_ssx1-fos 4 20 unspecified role unspecified role prey prey 35 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S4B atf2-fos 4 35 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 32 unspecified role unspecified role bait bait association association Fig S4B/C tle1-fos-2 4 35 unspecified role unspecified role prey prey promoter_region_~100bp_upstream_of_tss binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association Fig S4B/C atf2-nupr1-1 4 32 unspecified role unspecified role bait bait 41 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S4 B/C tle1-nupr1-2 4 34 unspecified role unspecified role bait bait 41 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S4 B/C syt_ssx2-meis2-1 4 31 unspecified role unspecified role bait bait 37 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S4C syt_ssx2-nupr1-1 4 31 unspecified role unspecified role bait bait 41 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S4C syt_ssx1-nupr1 4 20 unspecified role unspecified role bait bait 41 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S4B syt_ssx1-meis2 4 37 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait association association Fig S4B syt_ssx2-fos-1 4 31 unspecified role unspecified role bait bait 35 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S4C ss18-ssx2-cdkn2a 12 31 unspecified role unspecified role bait bait 43 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S5B atf2-cdkn2a 12 21 unspecified role unspecified role bait bait 43 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S5B tle1-cdkn2a 12 43 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 44 unspecified role unspecified role bait bait association association Fig S5B tle1-dus1 12 44 unspecified role unspecified role bait bait 38 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S5B atf2-dus1 12 21 unspecified role unspecified role bait bait 38 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S5B atf2-fos 12 40 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role bait bait association association Fig S5B tle1-fos 12 40 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 44 unspecified role unspecified role bait bait association association Fig S5B tle1-meis2 12 36 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 44 unspecified role unspecified role bait bait association association Fig S5B atf2-meis2 12 36 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role bait bait association association Fig S5B syt18-ssx2-nupre1 12 31 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S5B atf2-nupr1 12 22 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role bait bait association association Fig S5B tle1-nupr1 12 44 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S5B syt_ssx2-meis2 12 36 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 unspecified role unspecified role bait bait association association Fig S5B syt_ssx2-fos 12 31 unspecified role unspecified role bait bait 40 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S5B syt_ssx2-dus1 12 31 unspecified role unspecified role bait bait 38 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S5B tle1-ezh2-1 11 42 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey association association Fig S6C, S7F. hdac1-ezh2-1 11 34 unspecified role unspecified role prey prey 42 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association Fig S6C ezh2-hdac1-3 11 42 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey association association Fig S6C ezh2-hdac1-4 2 47 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait association association Fig S6C tle1-ezh2-2 2 26 unspecified role unspecified role prey prey 44 unspecified role unspecified role bait bait 47 unspecified role unspecified role prey prey association association Fig S6C, S7F. hdac1-ezh2-2 2 26 unspecified role unspecified role prey prey 44 unspecified role unspecified role prey prey 47 unspecified role unspecified role bait bait association association Fig S6C eed-atf2 11 23 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey 32 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 34 unspecified role unspecified role prey prey 42 unspecified role unspecified role prey prey association association Fig S6D ezh2-atf2 11 31 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey 33 unspecified role unspecified role prey prey 32 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 42 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey association association Fig S6D suz12-atf2 11 34 unspecified role unspecified role prey prey 42 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 32 unspecified role unspecified role prey prey 33 unspecified role unspecified role prey prey 31 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait association association Fig S6D tle1-eed 11 34 unspecified role unspecified role bait bait 42 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey 33 unspecified role unspecified role prey prey association association Fig S6E tle1-eed-1 11 33 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait 42 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey association association Fig S6E atf2-eed 11 32 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey 42 unspecified role unspecified role prey prey 33 unspecified role unspecified role prey prey association association Fig S6E hdac1-eed-1 11 33 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait 42 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey association association Fig S6E tle1-atf2-3 2 21 unspecified role unspecified role prey prey 44 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey association association Fig 1C atf2-syt_ssx2-3 2 21 unspecified role unspecified role bait bait 44 unspecified role unspecified role prey prey 31 unspecified role unspecified role prey prey association association Fig 1C atf2-meis2 4 37 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 32 unspecified role unspecified role bait bait association association Fig S4B/C tle1-meis2 4 37 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association Fig S4B/C cre-atf2-1 7 31 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 5-prime_infrared_dye_700 tag tag certain certain sequence position certain certain certain sequence position certain 32 unspecified role unspecified role prey prey association association Fig 5E cre-syt_ssx2-2 7 34 unspecified role unspecified role prey prey 31 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait 5-prime_infrared_dye_700 tag tag certain certain sequence position certain certain certain sequence position certain association association Fig 5E