IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The eph-receptor a7 is a soluble tumor suppressor for follicular lymphoma. The eph-receptor a7 is a soluble tumor suppressor for follicular lymphoma. Cell (0092-8674) 2011 imex curation Oricchio E., Nanjangud G., Wolfe A.L., Schatz J.H., Mavrakis K.J., Jiang M., Liu X., Bruno J., Heguy A., Olshen A.B., Socci N.D., Teruya-Feldstein J., Weis-Garcia F., Tam W., Shaknovich R., Melnick A., Himanen J.P., Chaganti R.S., Wendel H.G. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Additional detail on constructs obtained from the authors. Wendelh@mskcc.org 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Oricchio E., Nanjangud G., Wolfe A.L., Schatz J.H., Mavrakis K.J., Jiang M., Liu X., Bruno J., Heguy A., Olshen A.B., Socci N.D., Teruya-Feldstein J., Weis-Garcia F., Tam W., Shaknovich R., Melnick A., Himanen J.P., Chaganti R.S., Wendel H.G. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail on constructs obtained from the authors. Wendelh@mskcc.org Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation The eph-receptor a7 is a soluble tumor suppressor for follicular lymphoma. The eph-receptor a7 is a soluble tumor suppressor for follicular lymphoma. Cell (0092-8674) 2011 imex curation Oricchio E., Nanjangud G., Wolfe A.L., Schatz J.H., Mavrakis K.J., Jiang M., Liu X., Bruno J., Heguy A., Olshen A.B., Socci N.D., Teruya-Feldstein J., Weis-Garcia F., Tam W., Shaknovich R., Melnick A., Himanen J.P., Chaganti R.S., Wendel H.G. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Additional detail on constructs obtained from the authors. Wendelh@mskcc.org 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Oricchio E., Nanjangud G., Wolfe A.L., Schatz J.H., Mavrakis K.J., Jiang M., Liu X., Bruno J., Heguy A., Olshen A.B., Socci N.D., Teruya-Feldstein J., Weis-Garcia F., Tam W., Shaknovich R., Melnick A., Himanen J.P., Chaganti R.S., Wendel H.G. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail on constructs obtained from the authors. Wendelh@mskcc.org Accepted 2011-DEC-15 by JYOTI Cell (0092-8674) 2011 Only protein-protein interactions imex curation The eph-receptor a7 is a soluble tumor suppressor for follicular lymphoma. The eph-receptor a7 is a soluble tumor suppressor for follicular lymphoma. Cell (0092-8674) 2011 imex curation Oricchio E., Nanjangud G., Wolfe A.L., Schatz J.H., Mavrakis K.J., Jiang M., Liu X., Bruno J., Heguy A., Olshen A.B., Socci N.D., Teruya-Feldstein J., Weis-Garcia F., Tam W., Shaknovich R., Melnick A., Himanen J.P., Chaganti R.S., Wendel H.G. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Additional detail on constructs obtained from the authors. Wendelh@mskcc.org 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Oricchio E., Nanjangud G., Wolfe A.L., Schatz J.H., Mavrakis K.J., Jiang M., Liu X., Bruno J., Heguy A., Olshen A.B., Socci N.D., Teruya-Feldstein J., Weis-Garcia F., Tam W., Shaknovich R., Melnick A., Himanen J.P., Chaganti R.S., Wendel H.G. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail on constructs obtained from the authors. Wendelh@mskcc.org Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation The eph-receptor a7 is a soluble tumor suppressor for follicular lymphoma. The eph-receptor a7 is a soluble tumor suppressor for follicular lymphoma. Cell (0092-8674) 2011 imex curation Oricchio E., Nanjangud G., Wolfe A.L., Schatz J.H., Mavrakis K.J., Jiang M., Liu X., Bruno J., Heguy A., Olshen A.B., Socci N.D., Teruya-Feldstein J., Weis-Garcia F., Tam W., Shaknovich R., Melnick A., Himanen J.P., Chaganti R.S., Wendel H.G. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Additional detail on constructs obtained from the authors. Wendelh@mskcc.org 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Oricchio E., Nanjangud G., Wolfe A.L., Schatz J.H., Mavrakis K.J., Jiang M., Liu X., Bruno J., Heguy A., Olshen A.B., Socci N.D., Teruya-Feldstein J., Weis-Garcia F., Tam W., Shaknovich R., Melnick A., Himanen J.P., Chaganti R.S., Wendel H.G. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail on constructs obtained from the authors. Wendelh@mskcc.org Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation efna4_human Ephrin-A4 EFNA4 EPLG4 LERK4 EPH-related receptor tyrosine kinase ligand 4 protein protein human Homo sapiens Human MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRIL DIP protein P52798 original sequence version: 88 ABE8D5443A9AF28D epha7_human Ephrin type-A receptor 7 EPHA7 EHK3 HEK11 EPH-like kinase 11 EPH homology kinase 3 protein protein human Homo sapiens Human MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSLKTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV 479B9CA0D2BB06EB efna5_human Ephrin-A5 EFNA5 EPLG7 LERK7 EPH-related receptor tyrosine kinase ligand 7 AL-1 protein protein human Homo sapiens Human MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL DIP protein P52803 original sequence version: 83 DIP protein P52803 original sequence version: 81 DIP protein P52803 original sequence version: 82 DIP protein P52803 original sequence version: 90 DIP protein P52803 original sequence version: 109 6893B1CCACFF3F57 epha3_human Ephrin type-A receptor 3 EPHA3 ETK ETK1 TYRO4 Tyrosine-protein kinase receptor ETK1 HEK Tyrosine-protein kinase TYRO4 EPH-like kinase 4 protein protein human Homo sapiens Human MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQVVMIAISAAVAIILLTVVIYVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPHTYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVGPQKKIISSIKALETQSKNGPVPV BE04DBF958245424 efna1_mouse Ephrin-A1 Efna1 Epgl1 Epl1 Lerk1 EPH-related receptor tyrosine kinase ligand 1 Immediate early response protein B61 protein protein mouse Mus musculus Mouse MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYSAAPRLFPLVWAVLLLPLLLLQSQ 5A8F3A6E2091E868 epha2_human Ephrin type-A receptor 2 Tyrosine-protein kinase receptor ECK Epithelial cell kinase EPHA2 ECK protein protein human Homo sapiens Human MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGGVAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPI DIP protein P29317 original sequence version: 111 DIP protein P29317 original sequence version: 126 DIP protein P29317 original sequence version: 141 DIP protein P29317 original sequence version: 146 845D7E1BBCCAACCC epha7-epha2 2 6 unspecified role unspecified role bait bait c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 10 unspecified role unspecified role prey prey human-raji Homo sapiens RAJI Burkitt lymphoma cells raji Human Burkitt lymphoma RAJI cells physical association physical association Fig. 5B epha7-epha2-1 4 10 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-dohh2 Human DOHH2 lymphoma follicular B cell dohh2 DoHH2 lymphoma, follicular, B cells 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 21 19 physical association physical association Supp. Fig. 5C epha2-epha7 1 6 unspecified role unspecified role neutral component neutral component c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 10 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 26 29 direct interaction direct interaction Supp. Fig. 5N epha3-epha7 1 6 unspecified role unspecified role neutral component neutral component c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 8 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 34 36 direct interaction direct interaction Supp. Fig. 5N efna1-epha7 1 6 unspecified role unspecified role neutral component neutral component c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 9 unspecified role unspecified role neutral component neutral component c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 41 45 direct interaction direct interaction Supp. Fig. 5P efna4-epha7 1 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 52 48 direct interaction direct interaction Supp. Fig. 5P efna5-epha7 1 7 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. direct interaction direct interaction Supp. Fig. 5P efna1-epha7-2 3 9 unspecified role unspecified role bait bait c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role prey prey c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range Q15375:p.Thr105Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T Q Wed May 02 20:25:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr105gln' Tue Jun 30 17:12:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr105Gln' direct interaction direct interaction Supp. Fig. 5S Normal B-lymphocytes express only a truncated EPHA7 protein that lacks the intracellular domains - exact coordinates of truncation not given.