I2D I2D Microsomal prostaglandin E synthase-1 promotes hepatocarcinogenesis through activation of a novel EGR1/β-catenin signaling axis. Microsomal prostaglandin E synthase-1 promotes hepatocarcinogenesis through activation of a novel EGR1/β-catenin signaling axis. Oncogene (0950-9232) 2012 imex curation Lu D., Han C., Wu T. Cancer - Interactions investigated in the context of cancer Nuclear extracts of Huh-7 cells were obtained and subjected to immunoprecipitation followed by western blotting analysis. Author confirms that all constructs are of human origin. twu@tulane.edu 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lu D., Han C., Wu T. Cancer - Interactions investigated in the context of cancer Nuclear extracts of Huh-7 cells were obtained and subjected to immunoprecipitation followed by western blotting analysis. Author confirms that all constructs are of human origin. twu@tulane.edu Accepted 2013-JAN-15 by MGT 04-Feb-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Microsomal prostaglandin E synthase-1 promotes hepatocarcinogenesis through activation of a novel EGR1/β-catenin signaling axis. Microsomal prostaglandin E synthase-1 promotes hepatocarcinogenesis through activation of a novel EGR1/β-catenin signaling axis. Oncogene (0950-9232) 2012 imex curation Lu D., Han C., Wu T. Cancer - Interactions investigated in the context of cancer Nuclear extracts of Huh-7 cells were obtained and subjected to immunoprecipitation followed by western blotting analysis. Author confirms that all constructs are of human origin. twu@tulane.edu 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lu D., Han C., Wu T. Cancer - Interactions investigated in the context of cancer Nuclear extracts of Huh-7 cells were obtained and subjected to immunoprecipitation followed by western blotting analysis. Author confirms that all constructs are of human origin. twu@tulane.edu Accepted 2013-JAN-15 by MGT 04-Feb-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Microsomal prostaglandin E synthase-1 promotes hepatocarcinogenesis through activation of a novel EGR1/β-catenin signaling axis. Microsomal prostaglandin E synthase-1 promotes hepatocarcinogenesis through activation of a novel EGR1/β-catenin signaling axis. Oncogene (0950-9232) 2012 imex curation Lu D., Han C., Wu T. Cancer - Interactions investigated in the context of cancer Nuclear extracts of Huh-7 cells were obtained and subjected to immunoprecipitation followed by western blotting analysis. Author confirms that all constructs are of human origin. twu@tulane.edu 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lu D., Han C., Wu T. Cancer - Interactions investigated in the context of cancer Nuclear extracts of Huh-7 cells were obtained and subjected to immunoprecipitation followed by western blotting analysis. Author confirms that all constructs are of human origin. twu@tulane.edu Accepted 2013-JAN-15 by MGT 04-Feb-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 itf2_human Transcription factor 4 Immunoglobulin transcription factor 2 SL3-3 enhancer factor 2 ITF2 SEF2 TCF4 BHLHB19 Class B basic helix-loop-helix protein 19 protein protein human Homo sapiens Human MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITSNNDDEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM DIP protein P15884 original sequence version: 159 DIP protein P15884 original sequence version: 93 DIP protein P15884 original sequence version: 116 53459FC7989D9487 lef1_human Lymphoid enhancer-binding factor 1 LEF1 T cell-specific transcription factor 1-alpha protein protein human Homo sapiens Human MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI DIP protein Q9UJU2 original sequence version: 136 DIP protein Q9UJU2 original sequence version: 73 D480D440698EEFE3 egr1_human Early growth response protein 1 EGR1 KROX24 ZNF225 AT225 Nerve growth factor-induced protein A Transcription factor ETR103 Transcription factor Zif268 Zinc finger protein 225 Zinc finger protein Krox-24 protein protein human Homo sapiens Human MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC 768CE670D9743E4E ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E ctnnb1-egr1 3 8 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association 5c Huh-7 cells transfected with pCMV-mPGES-1 displayed reduced immunoprecipitation of GSK3Beta but increased levels of EGR1, TCF4 and LEF1. Anti-PGE2 antibody treatment partially reverses mPGES-1-mediated reduction of GSK-3Beta. egr1-ctnnb1 2 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 6a Overexpression of mPGES-1 increased nuclear β-catenin association with EGR1, whereas mPGES-1 knockdown decreased such an interaction. tcf4-ctnnb1-3 2 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 6b Overexpression of EGR1 or mPGES-1 increases association of TCF4 with Beta-catenin. ctnnb1-lef1-8 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey association association 6c Association of LEF1, TCF4 and Beta-catenin is increased with over expression of mPGES-1 but reduced with RNAi to EGR1. ctnnb1-egr1-1 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 6d mPGES1 increases Beta-catenin binding to EGR1, but not Sumo-EGR1. egr1-ctnnb1-1 3 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 7a mPGES-1 overexpression increases association between Beta-catenin and EGR1. ctnnb1-egr1-3 3 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association 7b-1 mPGES-1 overexpression increases association between Beta-catenin and TCF4 and EGR1. lef1-ctnnb1-2 1 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait association association 7b mPGES-1 overexpression increases association between Beta-catenin and LEF1 and EGR1. tcf4-ctnnb1-6 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association 7b mPGES-1 overexpression increases association between Beta-catenin and TCF4 and EGR1. tcf4-ctnnb1-5 3 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 7c lef1-ctnnb1-1 3 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 7d mPGES-1 overexpression increases association between Beta-catenin and LEF1. ctnnb1-egr1-4 3 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association 7e mPGES-1 overexpression increases association between Beta-catenin and TCF4 and EGR1. ctnnb1-egr1-5 3 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 7f mPGES-1 increases β-catenin interaction with EGR1 ; this interaction is partially inhibited by GSK-3β.