IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Targeting androgen receptor in estrogen receptor-negative breast cancer. Targeting androgen receptor in estrogen receptor-negative breast cancer. Cancer Cell (1535-6108) 2011 imex curation Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu 23-Sept-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu Accepted 2011-AUG-03 by JYOTI 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation Targeting androgen receptor in estrogen receptor-negative breast cancer. Targeting androgen receptor in estrogen receptor-negative breast cancer. Cancer Cell (1535-6108) 2011 imex curation Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu 23-Sept-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-sum185pe Human SUM185PE sum185pe Human SUM185PE breast carcinoma cell line LAR (luminal androgen receptor) subtype, triple negative (ER-,PR-,HER2-) , PIK3CA activating mutation - H1047R. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu Accepted 2011-AUG-03 by JYOTI 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation Targeting androgen receptor in estrogen receptor-negative breast cancer. Targeting androgen receptor in estrogen receptor-negative breast cancer. Cancer Cell (1535-6108) 2011 imex curation Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu 23-Sept-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-hcc202 HUMAN HCC202 hcc202 Human HC202 ductal carcinoma cell line, ER-,PR-, p53-, HER2+. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-2316&Template=cellBiology ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu Accepted 2011-AUG-03 by JYOTI 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation Targeting androgen receptor in estrogen receptor-negative breast cancer. Targeting androgen receptor in estrogen receptor-negative breast cancer. Cancer Cell (1535-6108) 2011 imex curation Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu 23-Sept-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer I cannot see anything for Participant detection: so Antibody Detection should cover most things... Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu Accepted 2011-AUG-03 by JYOTI 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation Targeting androgen receptor in estrogen receptor-negative breast cancer. Targeting androgen receptor in estrogen receptor-negative breast cancer. Cancer Cell (1535-6108) 2011 imex curation Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu 23-Sept-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu Accepted 2011-AUG-03 by JYOTI 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation Targeting androgen receptor in estrogen receptor-negative breast cancer. Targeting androgen receptor in estrogen receptor-negative breast cancer. Cancer Cell (1535-6108) 2011 imex curation Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu 23-Sept-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ni M., Chen Y., Lim E., Wimberly H., Bailey S.T., Imai Y., Rimm D.L., Shirley Liu X., Brown M. Cancer - Interactions investigated in the context of cancer Formaldehyde was used as a cross linking agent. xsliu@jimmy.harvard.edu, myles_brown@dfci.harvard.edu Accepted 2011-AUG-03 by JYOTI 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation foxa1_human Hepatocyte nuclear factor 3-alpha FOXA1 HNF3A TCF3A Forkhead box protein A1 Transcription factor 3A protein protein human Homo sapiens Human MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS DIP protein P55317 original sequence version: 116 B2489523459EEB4C erbb3_human_gene Human ERBB3 gene gene human Homo sapiens Human tf7l2_human Transcription factor 7-like 2 TCF7L2 TCF4 HMG box transcription factor 4 T-cell-specific transcription factor 4 protein protein human Homo sapiens Human MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE DIP protein Q9NQB0 original sequence version: 101 DIP protein Q9NQB0 original sequence version: 99 DIP protein Q9NQB0 original sequence version: 116 4DD2D3CC814AE16E dep1a_human_gene DEP domain-containing protein 1A gene gene gene human Homo sapiens Human andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ DIP protein P10275 original sequence version: 220 DIP protein P10275-1 original sequence version: 213 DIP protein P10275 original sequence version: 216 DIP protein P10275 original sequence version: 143 DIP protein P10275 original sequence version: 174 DIP protein P10275 original sequence version: 169 DIP protein P10275 original sequence version: 188 DIP protein P10275-1 original sequence version: 188 DIP protein P10275 original sequence version: 196 DIP protein P10275 original sequence version: 217 DIP protein P10275-1 original sequence version: 217 DIP protein P10275-1 original sequence version: 207 A73432C55D39AE06 ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E ar-wnt7b 1 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 4A An AR binding site within the WNT7B gene locus (+1.5 kb of TSS) was identified (Figure 4A). ar-wnt7b-1 5 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association 4B DHT (5alpha-dihydrotestosterone) An AR binding site was found within the WNT7B gene locus (+1.5 kb of TSS). The occupancy of AR at this site was enriched only after DHT stimulation. ar-ctnnb1-1 4 12 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization 4E DHT (5alpha-dihydrotestosterone) DHT treatment induced the nuclear accumulation of both beta-catenin and AR. ar-ctnnb1-3 6 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association 5A DHT (5alpha-dihydrotestosterone) ctnnb1-ar-1 6 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association 5A DHT (5alpha-dihydrotestosterone) ar-erbb3 1 11 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association 6A An overlapping AR and FOXA1 binding site was found within the HER3 gene locus, close to the TSS. foxa1-erbb3 1 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association 6A An overlapping AR and FOXA1 binding site was found within the HER3 gene locus, close to the TSS. foxa1-erbb3-1 5 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association 6B FOXA1 binding at the HER3 gene ( close to the TSS) was dramatically increased after DHT treatment, and concomitantly, a substantially enhanced occupancy of both AR and beta-catenin was also verified at this same region. DHT ctnnb1-erbb3 5 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association 6B, S5H FOXA1 binding at the HER3 gene ( close to the TSS) was dramatically increased after DHT treatment, and concomitantly, a substantially enhanced occupancy of both AR and beta-catenin was also verified at this same region. DHT Inhibitors targeting AR and Wnt/beta-catenin pathways [AR (bicalutamide), Wnt/beta-catenin (IWP2 and IWR1)] were able to reduce the DHT-induced recruitment of AR and beta-catenin to the HER3 gene. I have replaced the word "abolish" with "reduce" in this text:- "Inhibitors targeting AR and Wnt/beta-catenin pathways were able to abolish" - as the effect of DHT was clearly NOT abolished...(imo) ar-erbb3-1 5 11 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association 6B, S5H FOXA1 binding at the HER3 gene ( close to the TSS) was dramatically increased after DHT treatment, and concomitantly, a substantially enhanced occupancy of both AR and beta-catenin was also verified at this same region. DHT Inhibitors targeting AR and Wnt/beta-catenin pathways [AR (bicalutamide), Wnt/β-catenin (IWP2 and IWR1)] were able to reduce the DHT-induced recruitment of AR and beta-catenin to the HER3 gene. I have replaced the word "abolish" with "reduce" in this text:- "Inhibitors targeting AR and Wnt/beta-catenin pathways were able to abolish" - as the effect of DHT was clearly NOT abolished...(imo) ar-wnt7b-2 3 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association S4G DHT (5alpha-dihydrotestosterone) ar-wnt7b-3 2 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association S4H DHT (5alpha-dihydrotestosterone) tcf7l2-erbb3 5 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association S5D TCF4 was able to occupy the same genomic region (as AR/FOXA1) in the absence of DHT, however recruitment of TCF4 to HER3 gradually declined after DHT stimulation. DHT foxa1-erbb3-2 2 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association S5E FOXA1 binding at the HER3 gene ( close to the TSS) was dramatically increased after DHT treatment, and concomitantly, a substantially enhanced occupancy of both AR and beta-catenin was also verified at this same region. DHT ar-erbb3-2 2 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association S5E FOXA1 binding at the HER3 gene ( close to the TSS) was dramatically increased after DHT treatment, and concomitantly, a substantially enhanced occupancy of both AR and beta-catenin was also verified at this same region. DHT ctnnb1-erbb3-1 2 12 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association S5E FOXA1 binding at the HER3 gene ( close to the TSS) was dramatically increased after DHT treatment, and concomitantly, a substantially enhanced occupancy of both AR and beta-catenin was also verified at this same region. DHT