I2D I2D Regulation of NF-κB activity by competition between RelA acetylation and ubiquitination. Regulation of NF-κB activity by competition between RelA acetylation and ubiquitination. Oncogene (0950-9232) 2012 imex curation Li H., Wittwer T., Weber A., Schneider H., Moreno R., Maine G.N., Kracht M., Schmitz M.L., Burstein E. Cancer - Interactions investigated in the context of cancer ezra.burstein@utsouthwestern.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Li H., Wittwer T., Weber A., Schneider H., Moreno R., Maine G.N., Kracht M., Schmitz M.L., Burstein E. Cancer - Interactions investigated in the context of cancer chIPs involving Histone H3 cannot be included as the identity of the H3 molecule is not known. ezra.burstein@utsouthwestern.edu Accepted 2013-JUN-03 by MGT 17-Jun-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Regulation of NF-κB activity by competition between RelA acetylation and ubiquitination. Regulation of NF-κB activity by competition between RelA acetylation and ubiquitination. Oncogene (0950-9232) 2012 imex curation Li H., Wittwer T., Weber A., Schneider H., Moreno R., Maine G.N., Kracht M., Schmitz M.L., Burstein E. Cancer - Interactions investigated in the context of cancer ezra.burstein@utsouthwestern.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. pull down pull down western blot western blot Immuno blot Immuno blot Li H., Wittwer T., Weber A., Schneider H., Moreno R., Maine G.N., Kracht M., Schmitz M.L., Burstein E. Cancer - Interactions investigated in the context of cancer ezra.burstein@utsouthwestern.edu Accepted 2013-JUN-03 by MGT 17-Jun-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Regulation of NF-κB activity by competition between RelA acetylation and ubiquitination. Regulation of NF-κB activity by competition between RelA acetylation and ubiquitination. Oncogene (0950-9232) 2012 imex curation Li H., Wittwer T., Weber A., Schneider H., Moreno R., Maine G.N., Kracht M., Schmitz M.L., Burstein E. Cancer - Interactions investigated in the context of cancer ezra.burstein@utsouthwestern.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Li H., Wittwer T., Weber A., Schneider H., Moreno R., Maine G.N., Kracht M., Schmitz M.L., Burstein E. Cancer - Interactions investigated in the context of cancer ezra.burstein@utsouthwestern.edu Accepted 2013-JUN-03 by MGT 17-Jun-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Regulation of NF-κB activity by competition between RelA acetylation and ubiquitination. Regulation of NF-κB activity by competition between RelA acetylation and ubiquitination. Oncogene (0950-9232) 2012 imex curation Li H., Wittwer T., Weber A., Schneider H., Moreno R., Maine G.N., Kracht M., Schmitz M.L., Burstein E. Cancer - Interactions investigated in the context of cancer ezra.burstein@utsouthwestern.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Li H., Wittwer T., Weber A., Schneider H., Moreno R., Maine G.N., Kracht M., Schmitz M.L., Burstein E. Cancer - Interactions investigated in the context of cancer chIp-re-chIp - sequential precipitation of Ubiquitin - using an anti-Ha antibody, was followed by ReLA re-precipitation. HA-Ubiquitin was present in this assay, but cannot be included as it's origin is unknown. ezra.burstein@utsouthwestern.edu Accepted 2013-JUN-03 by MGT 17-Jun-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS DIP protein Q04207 original sequence version: 158 DIP protein Q04207 original sequence version: 117 DIP protein Q04207-1 original sequence version: 117 DIP protein Q04207-1 original sequence version: 118 DIP protein Q04207 original sequence version: 119 DIP protein Q04207 original sequence version: 141 DIP protein Q04207-1 original sequence version: 141 DIP protein Q04207-1 original sequence version: 149 DIP protein Q04207 original sequence version: 149 DIP protein Q04207 original sequence version: 168 DIP protein Q04207 original sequence version: 125 BDF1673D2FE398B9 ikba_mouse NF-kappa-B inhibitor alpha I-kappa-B-alpha Nfkbia Ikba protein protein mouse Mus musculus Mouse MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAPLAAEPWKQQLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVITNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATNYNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVFGGQRLTL DIP protein Q9Z1E3 original sequence version: 86 DIP protein Q9Z1E3 original sequence version: 127 DIP protein Q9Z1E3 original sequence version: 91 E1783F8E1BA93813 icam1_mouse_gene ICAM1_MOUSE_GENE gene gene mouse Mus musculus Mouse p25799-pro_0000030313 Nuclear factor NF-kappa-B p50 subunit Nfkb1 DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein mouse Mus musculus Mouse MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHG 0597F8EA07635A94 1 431 0597F8EA07635A94 mmp13_mouse_gene MMP13_MOUSE_GENE gene gene mouse Mus musculus Mouse icam1_human_gene ICAM1_HUMAN_GENE gene gene human Homo sapiens Human nfkb1_mouse Nuclear factor NF-kappa-B p105 subunit DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Nfkb1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein mouse Mus musculus Mouse MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHGTINTKFKNGPKDCAKSDDEESLTLPEKETEGEGPSLPMACTKTEPIALASTMEDKEQDMGFQDNLFLEKALQLARRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRVGADLSLLDRWGNSVLHLAAKEGHDRILSILLKSRKAAPLIDHPNGEGLNAIHIAVMSNSLPCLLLLVAAGAEVNAQEQKSGRTALHLAVEYDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKAGEDEGVVPGTTPLDMAANWQVFDILNGKPYEPVFTSDDILPQGDMKQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQVHCLPLSSSSTRQHIDELRDSDSVCDSGVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQEGPIEGKI 91EA9C595E375C30 kb_oligonucleotide Oligonucleotide encoding canonical κB sequence dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) AGCTTACAAGGGACTTTCCGCTGGGGACTTTCCAGGG vcam1_mouse_gene VCAM1_MOUSE_GENE gene gene mouse Mus musculus Mouse cbp_mouse Histone lysine acetyltransferase CREBBP Crebbp Cbp Protein-lysine acetyltransferase CREBBP protein protein mouse Mus musculus Mouse MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKSPLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMAGHAGLNTAQAGGMTKMGMTGTTSPFGQPFSQTGGQQMGATGVNPQLASKQSMVNSLPAFPTDIKNTSVTTVPNMSQLQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGAGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPPAHQQMRTLNALGNNPMSIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGSLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPASGAQPPVIPPAQSVRPPNGPLPLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQPPNMMGTHANNIMAQAPTQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQAGVSQGQVPGAALPNPLNMLAPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSGQTPTPTPGSVPSAAQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPGTPLSQAAASIDNRVPTPSSVTSAETSSQQPGPDVPMLEMKTEVQTDDAEPEPTESKGEPRSEMMEEDLQGSSQVKEETDTTEQKSEPMEVEEKKPEVKVEAKEEEENSSNDTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQNTALIAPHQIQGRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMSPAGFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRANINNGMPPGRAGMGTPGSQMTPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQQPMPGMPRPVMSMQAQAAVAGPRMPNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPPQPAMGGLNPQGQALNIMNPGHNPNMTNMNPQYREMVRRQLLQHQQQQQQQQQQQQQQQNSASLAGGMAGHSQFQQPQGPGGYAPAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL DIP protein P45481 original sequence version: 148 DIP protein P45481 original sequence version: 126 DIP protein P45481 original sequence version: 152 DIP protein P45481 original sequence version: 115 DIP protein P45481 original sequence version: 127 DIP protein P45481 original sequence version: 123 DIP protein P45481 original sequence version: 149 DIP protein P45481 original sequence version: 156 DIP protein P45481 original sequence version: 169 DIP protein P45481 original sequence version: 175 DIP protein P45481 original sequence version: 135 D89AF52B7BD33347 rela-nfkb1-17 3 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association 5c The K4Q and K5Q mutants displayed slight predilection for p50 compared to IκB-α binding. kb-rela 2 13 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5c rela-icam1 4 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association 6C rela-vcam1 1 14 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait Q04207:p.[Lys122Gln;Lys123Gln;Lys310Gln;Lys314Gln;Lys315Gln] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K Q certain certain sequence position certain certain certain sequence position certain K Q certain certain sequence position certain certain certain sequence position certain K Q certain certain sequence position certain certain certain sequence position certain K Q certain certain sequence position certain certain certain sequence position certain K Q Fri Jul 22 11:01:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys123gln,lys310gln,lys315gln,lys122gln,lys314gln' Wed May 02 19:07:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys122gln,lys123gln,lys310gln,lys314gln,lys315gln' Tue Jun 30 15:38:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys122Gln;Lys123Gln;Lys310Gln;Lys314Gln;Lys315Gln]' association association 6D rela-vcam1-1 1 10 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait Q04207:p.[Lys122Gln;Lys123Gln;Lys310Gln;Lys314Gln;Lys315Gln] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K Q certain certain sequence position certain certain certain sequence position certain K Q certain certain sequence position certain certain certain sequence position certain K Q certain certain sequence position certain certain certain sequence position certain K Q certain certain sequence position certain certain certain sequence position certain K Q Fri Jul 22 11:01:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys123gln,lys310gln,lys315gln,lys122gln,lys314gln' Wed May 02 19:02:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys122gln,lys123gln,lys310gln,lys314gln,lys315gln' Tue Jun 30 16:15:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys122Gln;Lys123Gln;Lys310Gln;Lys314Gln;Lys315Gln]' association association 6G rela-mmp13 1 8 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait association association 6E The interaction with the K5Q mutant was increased 5hrs after TNF treatment. rela-icam1-1 1 15 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 3 TNF -at 1 hour after stimulation rela-mmp13-1 1 15 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association supp 3 TNF -at 1 hour after stimulation rela-vcam1-2 1 14 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait association association Supp 3 TNF -at 1 hour after stimulation