I2D I2D Identification of the cathelicidin peptide LL-37 as agonist for the type I insulin-like growth factor receptor. Identification of the cathelicidin peptide LL-37 as agonist for the type I insulin-like growth factor receptor. Oncogene (0950-9232) 2012 imex curation Girnita A., Zheng H., Gronberg A., Girnita L., Stahle M. Cancer - Interactions investigated in the context of cancer A sandwich ELISA: Antibodies against IGF-1R, was used for capture of it's corresponding receptor from MCF7 cell lysate. LL37 was added and and binding detected by an HRP- coupled antibody to LL37.The assay was quantified by measuring the amount of secondary antibody bound via a colourimetric reaction. Ada.Girnita@ki.se 15-Nov-2012: Contacted by pporras. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Girnita A., Zheng H., Gronberg A., Girnita L., Stahle M. Cancer - Interactions investigated in the context of cancer A sandwich ELISA: Antibodies against IGF-1R, was used for capture of it's corresponding receptor from MCF7 cell lysate. LL37 was added and and binding detected by an HRP- coupled antibody to LL37.The assay was quantified by measuring the amount of secondary antibody bound via a colourimetric reaction. Mouse embryonic fibroblasts with a targeted disruption of the mouse IGF-1R protein were used to over-express human IGF-1R. Ada.Girnita@ki.se Accepted 2012-OCT-31 by MGT 15-Nov-2012: Contacted by pporras. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Identification of the cathelicidin peptide LL-37 as agonist for the type I insulin-like growth factor receptor. Identification of the cathelicidin peptide LL-37 as agonist for the type I insulin-like growth factor receptor. Oncogene (0950-9232) 2012 imex curation Girnita A., Zheng H., Gronberg A., Girnita L., Stahle M. Cancer - Interactions investigated in the context of cancer A sandwich ELISA: Antibodies against IGF-1R, was used for capture of it's corresponding receptor from MCF7 cell lysate. LL37 was added and and binding detected by an HRP- coupled antibody to LL37.The assay was quantified by measuring the amount of secondary antibody bound via a colourimetric reaction. Ada.Girnita@ki.se 15-Nov-2012: Contacted by pporras. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Girnita A., Zheng H., Gronberg A., Girnita L., Stahle M. Cancer - Interactions investigated in the context of cancer A sandwich ELISA: Antibodies against IGF-1R, was used for capture of it's corresponding receptor from MCF7 cell lysate. LL37 was added and and binding detected by an HRP- coupled antibody to LL37.The assay was quantified by measuring the amount of secondary antibody bound via a colourimetric reaction. Ada.Girnita@ki.se Accepted 2012-OCT-31 by MGT 15-Nov-2012: Contacted by pporras. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Identification of the cathelicidin peptide LL-37 as agonist for the type I insulin-like growth factor receptor. Identification of the cathelicidin peptide LL-37 as agonist for the type I insulin-like growth factor receptor. Oncogene (0950-9232) 2012 imex curation Girnita A., Zheng H., Gronberg A., Girnita L., Stahle M. Cancer - Interactions investigated in the context of cancer A sandwich ELISA: Antibodies against IGF-1R, was used for capture of it's corresponding receptor from MCF7 cell lysate. LL37 was added and and binding detected by an HRP- coupled antibody to LL37.The assay was quantified by measuring the amount of secondary antibody bound via a colourimetric reaction. Ada.Girnita@ki.se 15-Nov-2012: Contacted by pporras. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Girnita A., Zheng H., Gronberg A., Girnita L., Stahle M. Cancer - Interactions investigated in the context of cancer A sandwich ELISA: Antibodies against IGF-1R, was used for capture of it's corresponding receptor from MCF7 cell lysate. LL37 was added and and binding detected by an HRP- coupled antibody to LL37.The assay was quantified by measuring the amount of secondary antibody bound via a colourimetric reaction. Ada.Girnita@ki.se Accepted 2012-OCT-31 by MGT 15-Nov-2012: Contacted by pporras. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database arrb1_human Beta-arrestin-1 Arrestin beta-1 ARRB1 ARR1 Non-visual arrestin-2 protein protein human Homo sapiens Human MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR DIP protein P49407 original sequence version: 138 DIP protein P49407 original sequence version: 69 DIP protein P49407 original sequence version: 92 DIP protein P49407 original sequence version: 103 0A3C135092338D10 igf1r_human Insulin-like growth factor 1 receptor Insulin-like growth factor I receptor IGF1R protein protein human Homo sapiens Human MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC DIP protein P08069 original sequence version: 170 DIP protein P08069 original sequence version: 109 DIP protein P08069 original sequence version: 139 DIP protein P08069 original sequence version: 185 AE8A735F87F745C8 p49913-pro_0000004724 Antibacterial peptide LL-37 CAMP CAP18 FALL39 18 kDa cationic antimicrobial protein HSD26 protein protein human Homo sapiens Human [LL-37, 37 aa] 134 170 98E9C4196E584E8F arrb1_mouse Beta-arrestin-1 Arrestin beta-1 Arrb1 protein protein mouse Mus musculus Mouse MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHACPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDNVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR DIP protein Q8BWG8 original sequence version: 91 389C24F8CDA06E64 igf1r-camp 2 6 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role bait bait human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells physical association physical association 1 igf1r-camp-1 3 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 2a, b,c igf1r-camp-2 1 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 2c,4b arrb1-igf1r 3 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 5b arrb1-igf1r-1 1 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 5b