I2D I2D Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Oncogene (0950-9232) 2011 imex curation Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-sk_mel_28 Homo sapiens SK-MEL-28 cell line derived from melanoma sk_mel_28 human SK-MEL-28 Species: human male 51 years old; Tissue: skin; Tumor: melanoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Accepted 2012-APR-13 by PPORRAS 19-Jun-2012: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Oncogene (0950-9232) 2011 imex curation Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-a375 Human malignant melanoma a375 Human malignant melanoma ATCC catalog # CRL-1872 confocal microscopy confocal microscopy immunostaining immunostaining Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Accepted 2012-APR-13 by PPORRAS 19-Jun-2012: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Oncogene (0950-9232) 2011 imex curation Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-g361 Human malignant melanoma g361 Human malignant melanoma ATCC catalog # CRL1424 ATCC catalog # CRL-1424 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Accepted 2012-APR-13 by PPORRAS 19-Jun-2012: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Oncogene (0950-9232) 2011 imex curation Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro adp ribosylase adp ribosylase assay adp ribosylase autoradiography autoradiography Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Accepted 2012-APR-13 by PPORRAS Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Oncogene (0950-9232) 2011 imex curation Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-a375 Human malignant melanoma a375 Human malignant melanoma ATCC catalog # CRL-1872 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Accepted 2012-APR-13 by PPORRAS 19-Jun-2012: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Oncogene (0950-9232) 2011 imex curation Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-g361 Human malignant melanoma g361 Human malignant melanoma ATCC catalog # CRL1424 ATCC catalog # CRL-1424 confocal microscopy confocal microscopy immunostaining immunostaining Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Accepted 2012-APR-13 by PPORRAS 19-Jun-2012: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Oncogene (0950-9232) 2011 imex curation Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pull down pull down anti tag western anti tag western blot anti tag western Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Accepted 2012-APR-13 by PPORRAS 19-Jun-2012: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Poly(ADP-ribose)-dependent regulation of Snail1 protein stability. Oncogene (0950-9232) 2011 imex curation Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rodriguez M.I., Gonzalez-Flores A., Dantzer F., Collard J., de Herreros A.G., Oliver F.J. Cancer - Interactions investigated in the context of cancer Author confirms that HA-Snail1 is mouse. joliver@ipb.csic.es Accepted 2012-APR-13 by PPORRAS 19-Jun-2012: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW DIP protein P09874 original sequence version: 189 DIP protein P09874 original sequence version: 183 DIP protein P09874 original sequence version: 166 DIP protein P09874 original sequence version: 117 DIP protein P09874 original sequence version: 143 DIP protein P09874 original sequence version: 136 DIP protein P09874 original sequence version: 137 DIP protein P09874 original sequence version: 147 DIP protein P09874 original sequence version: 193 DIP protein P09874 original sequence version: 202 DIP protein P09874 original sequence version: 171 DIP protein P09874 original sequence version: 153 DIP protein P09874 original sequence version: 175 6A5FC01EB91C046B snai1_mouse Zinc finger protein SNAI1 Snai1 Sna Protein snail homolog 1 protein protein mouse Mus musculus Mouse MPRSFLVRKPSDPRRKPNYSELQDACVEFTFQQPYDQAHLLAAIPPPEVLNPAASLPTLIWDSLLVPQVRPVAWATLPLRESPKAVELTSLSDEDSGKSSQPPSPPSPAPSSFSSTSASSLEAEAFIAFPGLGQLPKQLARLSVAKDPQSRKIFNCKYCNKEYLSLGALKMHIRSHTLPCVCTTCGKAFSRPWLLQGHVRTHTGEKPFSCSHCNRAFADRSNLRAHLQTHSDVKRYQCQACARTFSRMSLLHKHQESGCSGGPR 52E2061224A18DEB snai1_human Zinc finger protein SNAI1 Protein snail homolog 1 SNAI1 SNAH protein protein human Homo sapiens Human MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR DIP protein O95863 original sequence version: 109 DIP protein O95863 original sequence version: 141 70E298C9BB154115 parp1-snai1-8 4 9 enzyme enzyme neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 enzyme target enzyme target substrate substrate neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 adp ribosylation adp ribosylation reaction adp ribosylation 3a parp1-snai1-1 7 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4a, b, f, i KU0058948 LiCl parp1-snai1-2 3 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 4c snai1-parp1 5 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 4c snai1-parp1-1 3 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 4c parp1-snai1-3 5 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 4c, e KU0058948 TGF-Beta Doxorubicin parp1-snai1-4 7 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Minimal binding of PARP-1 is seen with the N-terminal region of Snail1. physical association physical association 4g snai1-parp1-2 8 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association S2d parp1-snai1-5 8 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association S2d snai1-parp1-3 1 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association S2d parp1-snai1-6 1 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association S2d parp1-snai1-7 2 9 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization 4d, S2c KU00058948 PJ-34 parp1-snai1-8 6 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization S2c KU00058948 PJ-34