I2D I2D Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Oncogene (0950-9232) 2011 imex curation Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy immunostaining immunostaining Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at Accepted 2012-SEP-03 by MGT 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Oncogene (0950-9232) 2011 imex curation Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at Accepted 2012-SEP-03 by MGT 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Oncogene (0950-9232) 2011 imex curation Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at Accepted 2012-SEP-03 by MGT 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Oncogene (0950-9232) 2011 imex curation Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at Accepted 2012-SEP-03 by MGT 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Oncogene (0950-9232) 2011 imex curation Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-hel Homo sapiens HEL erythroleukemia cell line hel human erythroleukemia established from the peripheral blood of a 30-year-old man with erythroleukemia (AML M6) in relapse (after treatment for Hodgkin's leukemia) confocal microscopy confocal microscopy immunostaining immunostaining Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at Accepted 2012-SEP-03 by MGT 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Oncogene (0950-9232) 2011 imex curation Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at Accepted 2012-SEP-03 by MGT 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Oncogene (0950-9232) 2011 imex curation Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database mouse-ba_f3 Mouse pro B cells IL-3 dependent mouse-baf3 EBI-6922762 ba_f3 Mouse pro B cells IL-3 dependent BA/F3 baf3 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at Accepted 2012-SEP-03 by MGT 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Oncogene (0950-9232) 2011 imex curation Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at Accepted 2012-SEP-03 by MGT 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control. Oncogene (0950-9232) 2011 imex curation Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-hel Homo sapiens HEL erythroleukemia cell line hel human erythroleukemia established from the peripheral blood of a 30-year-old man with erythroleukemia (AML M6) in relapse (after treatment for Hodgkin's leukemia) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jakel H., Weinl C., Hengst L. IBD - Inflammatory bowel disease Cancer - Interactions investigated in the context of cancer Author confirms that all p27Kip1 constructs are human and all JAK2 constructs are mouse. ludger.hengst@i-med.ac.at Accepted 2012-SEP-03 by MGT 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database jak2_human Tyrosine-protein kinase JAK2 Janus kinase 2 JAK2 protein protein human Homo sapiens Human MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSGEYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYFPRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLREALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG DIP protein O60674 original sequence version: 119 DIP protein O60674 original sequence version: 126 DIP protein O60674 original sequence version: 137 DIP protein O60674 original sequence version: 129 C30669EF1A7DA80C cdn1b_human Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 CDKN1B KIP1 protein protein human Homo sapiens Human MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT DIP protein P46527 original sequence version: 120 DIP protein P46527 original sequence version: 115 DIP protein P46527 original sequence version: 154 DIP protein P46527 original sequence version: 168 DIP protein P46527 original sequence version: 164 DIP protein P46527 original sequence version: 118 1118D58901CDF3FC jak2_mouse Tyrosine-protein kinase JAK2 Janus kinase 2 Jak2 protein protein mouse Mus musculus Mouse MGMACLTMTEMEATSTSPVHQNGDIPGSANSVKQIEPVLQVYLYHSLGQAEGEYLKFPSGEYVAEEICVAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHDILYRIRFYFPHWYCSGSSRTYRYGVSRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKEKDQTPLAVYNSVSYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEQFEVKESARGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDVQLYCDFPDIIDVSIKQANQECSNESRIVTVHKQDGKVLEIELSSLKEALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIHSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLSGTKRNFSNLKDLLNCYQMETVRSDSIIFQFTKCCPPKPKDKSNLLVFRTNGISDVQISPTLQRHNNVNQMVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHKTEVLLKVLDKAHRNYSESFFEAASMMSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLGVAKQLAWAMHFLEEKSLIHGNVCAKNILLIREEDRRTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDKHQLPAPKWTELANLINNCMDYEPDFRPAFRAVIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPVEFMRMIGNDKQGQMIVFHLIELLKSNGRLPRPEGCPDEIYVIMTECWNNNVSQRPSFRDLSLRVDQIRDSIAA DIP protein Q62120 original sequence version: 149 DIP protein Q62120 original sequence version: 109 DIP protein Q62120 original sequence version: 117 DIP protein Q62120 original sequence version: 110 7BA35989B880D0A6 cdn1b_mouse Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 Cdkn1b protein protein mouse Mus musculus Mouse MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVLAQESQDVSGSRQAVPLIGSQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPNAGTVEQTPKKPGLRRQT DIP protein P46414 original sequence version: 87 BAC30D648B9BA3D6 jak2-cdkn1b-4 6 11 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 3a Q62120 is required for phosphorylation of P46527 Q62120 increases degradation at protein level of P46527 jak2-cdkn1b-1 3 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain c-term range C-terminal range c-term range physical association physical association 3b, 3e cdkn1b-jak2-1 8 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 3b jak2-cdkn1b-2 7 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 3c cdkn1b-jak2-2 1 11 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P46527:p.Tyr88Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:46:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr88phe' Tue Jun 30 15:57:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr88Phe' p_tyr88 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p_tyr1007/8 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain colocalization colocalization 4a cdkn1b-jak2-3 5 11 unspecified role unspecified role neutral component neutral component P46527:p.Tyr88Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 18:35:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr88phe' Tue Jun 30 19:04:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr88Phe' p_tyr88 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component Q62120:p.Val617Phe mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain V F Wed May 02 17:54:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val617phe' Tue Jun 30 17:24:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val617Phe' p_tyr1007/8 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 4b cdkn1b-jak2-4 4 11 unspecified role unspecified role neutral component neutral component P46527:p.Tyr88Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 14:38:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr88phe' Tue Jun 30 18:59:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr88Phe' p_tyr88 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component Q62120:p.Val617Phe mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain V F Wed May 02 18:45:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val617phe' Tue Jun 30 18:40:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val617Phe' p_tyr1007/8 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization S3 cdkn1b-jak2-5 9 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 3c cdkn1b-jak2-6 2 11 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminal_kinase domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 2c