UniProt UniProt http://www.uniprot.org ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. EMBO Mol Med (1757-4676) 2011 mimix curation Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr 02-Apr-2014: Contacted by IntAct-Help. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr Accepted 2014-MAR-13 by MGT EMBO Mol Med (1757-4676) 2011 mimix curation ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. EMBO Mol Med (1757-4676) 2011 mimix curation Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr 02-Apr-2014: Contacted by IntAct-Help. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr Accepted 2014-MAR-13 by MGT EMBO Mol Med (1757-4676) 2011 mimix curation ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. EMBO Mol Med (1757-4676) 2011 mimix curation Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr 02-Apr-2014: Contacted by IntAct-Help. human-mda_mb_134 Homo sapiens epithelial breast cancer cell line MDA-MB-134 mda_134 Human breast carcinoma cell line MDA-MB-134 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr Accepted 2014-MAR-13 by MGT EMBO Mol Med (1757-4676) 2011 mimix curation ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. EMBO Mol Med (1757-4676) 2011 mimix curation Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr 02-Apr-2014: Contacted by IntAct-Help. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr Accepted 2014-MAR-13 by MGT EMBO Mol Med (1757-4676) 2011 mimix curation ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. EMBO Mol Med (1757-4676) 2011 mimix curation Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr 02-Apr-2014: Contacted by IntAct-Help. human-hcc-1500 Homo sapiens Breast Carcinoma cell line hcc-1500 HCC-1500 Human Breast Carcinoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sircoulomb F., Nicolas N., Ferrari A., Finetti P., Bekhouche I., Rousselet E., Lonigro A., Adélaïde J., Baudelet E., Esteyriès S., Wicinski J., Audebert S., Charafe-Jauffret E., Jacquemier J., Lopez M., Borg J.P., Sotiriou C., Popovici C., Bertucci F., Birnbaum D., Chaffanet M., Ginestier C. Cancer - Interactions investigated in the context of cancer chaffanetm@marseille.fnclcc.fr Accepted 2014-MAR-13 by MGT EMBO Mol Med (1757-4676) 2011 mimix curation phb2_human Prohibitin-2 BAP REA PHB2 D-prohibitin B-cell receptor-associated protein BAP37 Repressor of estrogen receptor activity protein protein human Homo sapiens Human MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK A887CC982BF85C80 ch60_human 60 kDa heat shock protein, mitochondrial HSPD1 HSP60 Heat shock protein 60 60 kDa chaperonin Chaperonin 60 Mitochondrial matrix protein P1 P60 lymphocyte protein HuCHA60 protein protein human Homo sapiens Human MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF DIP protein P10809 original sequence version: 142 E51E1BAD9615899C dcaf7_human DDB1- and CUL4-associated factor 7 DCAF7 HAN11 WD repeat-containing protein An11 homolog WDR68 WD repeat-containing protein 68 protein protein human Homo sapiens Human MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV DIP protein P61962 original sequence version: 141 DIP protein P61962 original sequence version: 70 DIP protein P61962 original sequence version: 117 794CC69A45D0CC7C zn703_human Zinc finger protein 703 ZNF703 ZEPPO1 ZPO1 Zinc finger elbow-related proline domain protein 1 protein protein human Homo sapiens Human MSDSPAGSNPRTPESSGSGSGGGGKRPAVPAAVSLLPPADPLRQANRLPIRVLKMLSAHTGHLLHPEYLQPLSSTPVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLNSVAAAANGLGAEKDPGRSAPGAASAAAALKQLGDSPAEDKSSFKPYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSSSPGGSRGGSPHHSDCKNGGGVGGGELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRKSEPPSALVGAGHVAPVSPYKPGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGLGLPPGKPPSSSPLTGASPPSFLQGLCRDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSLKAGGYPLVYPGHPLQPAALSSSAAQAALPGHPLYTYGFMLQNEPLPHSCNWVAASGPCDKRFATSEELLSHLRTHTALPGAEKLLAAYPGASGLGSAAAAAAAAASCHLHLPPPAAPGSPGSLSLRNPHTLGLSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ znf703-dcaf7 1 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association 2C left, Supp table 7. znf703-dcaf7-6 5 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association 2C right znf703-dcaf7-7 3 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association 2C right znf703-dcaf7-8 2 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Supplementary figure 6 dcaf7-znf703 4 9 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 2D