I2D I2D RAC3 is a pro-migratory co-activator of ERα. RAC3 is a pro-migratory co-activator of ERα. Oncogene (0950-9232) 2011 imex curation Walker MP., Zhang M., Le TP., Wu P., Laine M., Greene GL. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Author confirms that His-Rac3 is human. ggreene@uchicago.edu 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Walker MP., Zhang M., Le TP., Wu P., Laine M., Greene GL. Apoptosis - Interactions involving proteins with a function related to apoptosis Author confirms that His-Rac3 is human. ggreene@uchicago.edu Accepted 2011-JUL-01 by JYOTI 26-Sep-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 jyoti Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database RAC3 is a pro-migratory co-activator of ERα. RAC3 is a pro-migratory co-activator of ERα. Oncogene (0950-9232) 2011 imex curation Walker MP., Zhang M., Le TP., Wu P., Laine M., Greene GL. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Author confirms that His-Rac3 is human. ggreene@uchicago.edu 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mcf7-c4-12 Human ERalpha-negative mammary adenocarcinoma cells mcf7-c4-12 Estrogen Receptor alpha- negative mammary gland adenocarcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Walker MP., Zhang M., Le TP., Wu P., Laine M., Greene GL. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were treated with 10nM Estradiol for 1hr Author confirms that His-Rac3 is human. ggreene@uchicago.edu Accepted 2011-JUL-01 by JYOTI 26-Sep-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 jyoti Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database RAC3 is a pro-migratory co-activator of ERα. RAC3 is a pro-migratory co-activator of ERα. Oncogene (0950-9232) 2011 imex curation Walker MP., Zhang M., Le TP., Wu P., Laine M., Greene GL. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Author confirms that His-Rac3 is human. ggreene@uchicago.edu 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mcf7-c4-12 Human ERalpha-negative mammary adenocarcinoma cells mcf7-c4-12 Estrogen Receptor alpha- negative mammary gland adenocarcinoma cells 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Walker MP., Zhang M., Le TP., Wu P., Laine M., Greene GL. Apoptosis - Interactions involving proteins with a function related to apoptosis MCF7-C4-12 cells were seeded in 48-well dishes and transfected with equal amounts of pSG-5 luciferase, GAL-4 vector, VP-16 ERalpha and RTK using Lipofectamine 2000 (Invitrogen). Plates were read using a dual luciferase protocol (Hampf and Gossen, 2006) on a Wallac Microbeta Jet Luminometer. Author confirms that His-Rac3 is human. ggreene@uchicago.edu Accepted 2011-JUL-01 by JYOTI 26-Sep-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 jyoti Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database RAC3 is a pro-migratory co-activator of ERα. RAC3 is a pro-migratory co-activator of ERα. Oncogene (0950-9232) 2011 imex curation Walker MP., Zhang M., Le TP., Wu P., Laine M., Greene GL. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Author confirms that His-Rac3 is human. ggreene@uchicago.edu 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro phage display phage display nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Walker MP., Zhang M., Le TP., Wu P., Laine M., Greene GL. Apoptosis - Interactions involving proteins with a function related to apoptosis Author confirms that His-Rac3 is human. ggreene@uchicago.edu Accepted 2011-JUL-01 by JYOTI 26-Sep-2011: Contacted by JYOTI. Human breast cDNA library (Novagen). Oncogene (0950-9232) 2011 jyoti Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database hax1_human HCLS1-associated protein X-1 HAX1 HS1BP1 HS1-associating protein X-1 HS1-binding protein 1 protein protein human Homo sapiens Human MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR DIP protein O00165 original sequence version: 138 87EEF0C46857704B asf1a_human Histone chaperone ASF1A Anti-silencing function protein 1 homolog A CCG1-interacting factor A ASF1A CGI-98 HSPC146 protein protein human Homo sapiens Human MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESHMDCM DIP protein Q9Y294 original sequence version: 111 DIP protein Q9Y294 original sequence version: 131 DIP protein Q9Y294 original sequence version: 106 This sequence has been withdrawn from Uniprot. 9819D531D3A9FC68 myl6_human Myosin light polypeptide 6 MYL6 Smooth muscle and nonmuscle myosin light chain alkali 6 Myosin light chain alkali 3 Myosin light chain 3 17 kDa myosin light chain protein protein human Homo sapiens Human MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG A2B7B4F41179523D ndrg2_human Protein NDRG2 NDRG2 KIAA1248 SYLD Protein Syld709613 N-myc downstream-regulated gene 2 protein protein protein human Homo sapiens Human MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC rac3_human Ras-related C3 botulinum toxin substrate 3 p21-Rac3 RAC3 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF DIP protein P60763 original sequence version: 54 560BBC26BB7CDF4A blcap_human Bladder cancer-associated protein BLCAP BC10 Bladder cancer 10 kDa protein protein protein human Homo sapiens Human MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT dnm1l_human Dynamin-1-like protein Dynamin-like protein Dnm1p/Vps1p-like protein Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-related protein 1 Dynamin-like protein 4 Dynamin-like protein IV DNM1L DLP1 DRP1 protein protein human Homo sapiens Human MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW F9521A376B785B71 F9521A376B785B71 esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV DIP protein P03372 original sequence version: 214 DIP protein P03372 original sequence version: 139 DIP protein P03372 original sequence version: 167 5455C57AB0CCCAA7 atf1_human Cyclic AMP-dependent transcription factor ATF-1 Activating transcription factor 1 Protein TREB36 ATF1 protein protein human Homo sapiens Human MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV DIP protein P18846 original sequence version: 120 BAFECBFFB244FCED edf1_human Endothelial differentiation-related factor 1 Multiprotein-bridging factor 1 EDF1 protein protein human Homo sapiens Human MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK ADC2C5384BF85C11 senp5_human Sentrin-specific protease 5 SENP5 Sentrin/SUMO-specific protease SENP5 FKSG45 protein protein human Homo sapiens Human MKKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWNRQLRHFQGRKKALQIQKTWIKDEPLCAKTKFNVATQNVSTLSSKVKRKDAKHFISSSKTLLRLQAEKLLSSAKNSDHEYCREKNLLKAVTDFPSNSALGQANGHRPRTDPQPSDFPMKFNGESQSPGESGTIVVTLNNHKRKGFCYGCCQGPEHHRNGGPLIPKKFQLNQHRRIKLSPLMMYEKLSMIRFRYRILRSQHFRTKSKVCKLRKAQRSWVQKVTGDHQETRRENGEGGSCSPFPSPEPKDPSCRHQPYFPDMDSSAVVKGTNSHVPDCHTKGSSFLGKELSLDEAFPDQQNGSATNAWDQSSCSSPKWECTELIHDIPLPEHRSNTMFISETEREIMTLGQENQTSSVSDDRVKLSVSGADTSVSSVDGPVSQKAVQNENSYQMEEDGSLKQSILSSELLDHPYCKSPLEAPLVCSGLKLENQVGGGKNSQKASPVDDEQLSVCLSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYRARHQKCNFRIFYNKHMLDMDDLATLDGQNWLNDQVINMYGELIMDAVPDKVHFFNSFFHRQLVTKGYNGVKRWTKKVDLFKKSLLLIPIHLEVHWSLITVTLSNRIISFYDSQGIHFKFCVENIRKYLLTEAREKNRPEFLQGWQTAVTKCIPQQKNDSDCGVFVLQYCKCLALEQPFQFSQEDMPRVRKRIYKELCECRLMD DIP protein Q96HI0 original sequence version: 119 rac3-esr1 1 12 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 9 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1a, b The RAC3/ERalpha interaction was estradiol dependent and increased two-fold in the presence of GTP. esr1-rac3 4 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey direct interaction direct interaction esr1-asf1a 4 6 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait direct interaction direct interaction Supplementary Table 1 esr1-atf1 4 12 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey direct interaction direct interaction Supplementary Table 1 esr1-blcap 4 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey direct interaction direct interaction Supplementary Table 1 esr1-dnm1l 4 12 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey direct interaction direct interaction Supplementary Table 1 esr1-hax1 4 5 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait direct interaction direct interaction Supplementary Table 1 esr1-myl6 4 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait direct interaction direct interaction Supplementary Table 1 esr1-ndrg2 4 12 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey direct interaction direct interaction Supplementary Table 1 esr1-senp5 4 12 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey direct interaction direct interaction Supplementary Table 1 esr1-edf1 4 12 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey direct interaction direct interaction Supplementary Table 1 esr1-rac3-1 2 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1d esr1-rac3-2 3 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1c Rac3 interacts with ERalpha in the presence of 10nM Estradiol. Author confirms that Gal4-Rac3 is human. esr1-asf1a-1 3 6 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association ASF1A interacts with ERalpha in the presence of 10nM Estradiol. Supplemental Table 1 esr1-blcap-1 3 12 unspecified role unspecified role bait bait region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association BLCAP interacts with ERalpha in the presence of 10nM Estradiol. Supplemental Table 1 esr1-dnm1l-1 3 11 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplemental Table 1 DNM1L interaction with ERalpha is Estradiol independent. esr1-hax1-1 3 5 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplemental Table 1 HAX1 interacts with ERalpha in the presence of 10nM Estradiol. esr1-ndrg2-1 3 12 unspecified role unspecified role bait bait region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplemental Table 1 NDRG2 interacts with ERalpha in the presence of 10nM Estradiol. esr1-senp5-1 3 12 unspecified role unspecified role bait bait region vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region gal4 ad gal4 activation domain gal4 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplemental Table 1 SENP5 interaction with ERalpha is Estradiol independent. esr1-rac3-3 2 9 unspecified role unspecified role prey prey P60763:p.Ser151Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:36:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser151ala' Tue Jun 30 19:22:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser151Ala' 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3d