I2D I2D Sumoylation of ING2 regulates the transcription mediated by Sin3A. Sumoylation of ING2 regulates the transcription mediated by Sin3A. Oncogene (0950-9232) 2010 imex curation Ythier D., Larrieu D., Binet R., Binda O., Brambilla C., Gazzeri S., Pedeux R. Cancer - Interactions investigated in the context of cancer remy.pedeux@univ-rennes1.fr 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ythier D., Larrieu D., Binet R., Binda O., Brambilla C., Gazzeri S., Pedeux R. Cancer - Interactions investigated in the context of cancer remy.pedeux@univ-rennes1.fr Accepted 2011-FEB-02 by ORCHARD 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Sumoylation of ING2 regulates the transcription mediated by Sin3A. Sumoylation of ING2 regulates the transcription mediated by Sin3A. Oncogene (0950-9232) 2010 imex curation Ythier D., Larrieu D., Binet R., Binda O., Brambilla C., Gazzeri S., Pedeux R. Cancer - Interactions investigated in the context of cancer remy.pedeux@univ-rennes1.fr 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference pull down pull down western blot western blot Immuno blot Immuno blot Ythier D., Larrieu D., Binet R., Binda O., Brambilla C., Gazzeri S., Pedeux R. Cancer - Interactions investigated in the context of cancer Author confirms that HIS-SUMO1 construct if of human origin. remy.pedeux@univ-rennes1.fr Accepted 2011-FEB-02 by ORCHARD 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Sumoylation of ING2 regulates the transcription mediated by Sin3A. Sumoylation of ING2 regulates the transcription mediated by Sin3A. Oncogene (0950-9232) 2010 imex curation Ythier D., Larrieu D., Binet R., Binda O., Brambilla C., Gazzeri S., Pedeux R. Cancer - Interactions investigated in the context of cancer remy.pedeux@univ-rennes1.fr 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ythier D., Larrieu D., Binet R., Binda O., Brambilla C., Gazzeri S., Pedeux R. Cancer - Interactions investigated in the context of cancer remy.pedeux@univ-rennes1.fr Accepted 2011-FEB-02 by ORCHARD 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database ing2_human Inhibitor of growth protein 2 ING2 p33ING2 Inhibitor of growth 1-like protein p32 ING1L protein protein human Homo sapiens Human MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKYKKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKMDSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREASPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKDRRSR DC85A6ECAF7A5D81 sin3a_human Paired amphipathic helix protein Sin3a SIN3A Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein human Homo sapiens Human MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQVTDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIELLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q96ST3 original sequence version: 128 DIP protein Q96ST3 original sequence version: 147 E6A329BE0EAD84CD ostp_human_gene Human osteopontin gene gene human Homo sapiens Human tmm71_human_gene Human Transmembrane Protein 71 gene gene human Homo sapiens Human sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63165 original sequence version: 36 DIP protein P63165 original sequence version: 40 DIP protein P63165 original sequence version: 124 DIP protein P63165 original sequence version: 125 DIP protein P63165 original sequence version: 83 DIP protein P63165 original sequence version: 85 DIP protein P63165 original sequence version: 81 DIP protein P63165 original sequence version: 84 DIP protein P63165 original sequence version: 103 DIP protein P63165 original sequence version: 100 DIP protein P63165 original sequence version: 95 DIP protein P63165 original sequence version: 98 DIP protein P63165 original sequence version: 101 DIP protein P63165-1 original sequence version: 131 DIP protein P63165 original sequence version: 102 DIP protein P63165 original sequence version: 122 DIP protein P63165 original sequence version: 62 DIP protein P63165 original sequence version: 119 DIP protein P63165 original sequence version: 82 89BE97D2D054FB33 ing2-sin3a 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey Q9H160:p.Lys195Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R Wed May 02 15:25:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys195arg' Tue Jun 30 17:08:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys195Arg' Q9H160:p.Glu197Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E A Wed May 02 16:00:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu197ala' Tue Jun 30 17:03:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu197Ala' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1a, 4a, 4c ing2-sumo1 2 4 unspecified role unspecified role prey prey Q9H160:p.Glu197Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E A Wed May 02 16:18:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu197ala' Tue Jun 30 17:44:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu197Ala' Q9H160:p.Lys195Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R Wed May 02 15:39:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys195arg' Tue Jun 30 19:07:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys195Arg' 8 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1c, 2c, 2d ostp-ing2 3 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey association association Fig. 5d tmm71-ing2-1 3 4 unspecified role unspecified role bait bait Q9H160:p.Glu197Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E A Wed May 02 19:11:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu197ala' Tue Jun 30 18:36:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu197Ala' 7 unspecified role unspecified role prey prey association association Fig. 5d, 6c tmm71-sin3a 3 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association Fig. 6c Interaction not observed in the absence of ING2. tmm71-sin3a 3 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association Fig. 6c