I2D I2D A previously unrecognized promoter of LMO2 forms part of a transcriptional regulatory circuit mediating LMO2 expression in a subset of T-acute lymphoblastic leukaemia patients. A previously unrecognized promoter of LMO2 forms part of a transcriptional regulatory circuit mediating LMO2 expression in a subset of T-acute lymphoblastic leukaemia patients. Oncogene (0950-9232) 2010 imex curation Oram SH., Thoms JA., Pridans C., Janes ME., Kinston SJ., Anand S., Landry JR., Lock RB., Jayaraman PS., Huntly BJ., Pimanda JE., Gottgens B. Cancer - Interactions investigated in the context of cancer Author confirms that ERG and LMO2 constructs are of human origin whereas the FLI1 construct is murine. bg200@cam.ac.uk 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Oram SH., Thoms JA., Pridans C., Janes ME., Kinston SJ., Anand S., Landry JR., Lock RB., Jayaraman PS., Huntly BJ., Pimanda JE., Gottgens B. Cancer - Interactions investigated in the context of cancer Author confirms that ERG and LMO2 constructs are of human origin whereas the FLI1 construct is murine. bg200@cam.ac.uk Accepted 2011-JAN-24 by ORCHARD 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database A previously unrecognized promoter of LMO2 forms part of a transcriptional regulatory circuit mediating LMO2 expression in a subset of T-acute lymphoblastic leukaemia patients. A previously unrecognized promoter of LMO2 forms part of a transcriptional regulatory circuit mediating LMO2 expression in a subset of T-acute lymphoblastic leukaemia patients. Oncogene (0950-9232) 2010 imex curation Oram SH., Thoms JA., Pridans C., Janes ME., Kinston SJ., Anand S., Landry JR., Lock RB., Jayaraman PS., Huntly BJ., Pimanda JE., Gottgens B. Cancer - Interactions investigated in the context of cancer Author confirms that ERG and LMO2 constructs are of human origin whereas the FLI1 construct is murine. bg200@cam.ac.uk 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Oram SH., Thoms JA., Pridans C., Janes ME., Kinston SJ., Anand S., Landry JR., Lock RB., Jayaraman PS., Huntly BJ., Pimanda JE., Gottgens B. Cancer - Interactions investigated in the context of cancer Author confirms that ERG and LMO2 constructs are of human origin whereas the FLI1 construct is murine. bg200@cam.ac.uk Accepted 2011-JAN-24 by ORCHARD 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database fli1_mouse Friend leukemia integration 1 transcription factor Retroviral integration site protein Fli-1 Fli1 Fli-1 protein protein mouse Mus musculus Mouse MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCNKLVGGGEANPMNYNSYMDEKNGPPPPNMTTNERRVIVPADPTLWTQEHVRQWLEWAIKEYGLMEIDTSFFQNMDGKELCKMNKEDFLRATSAYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLNVKEDPSYDSVRRGAWNNNMNSGLNKSPLLGGSQTMGKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTETSMYKYPSDISYMPSYHAHQQKVNFVPSHPSSMPVTSSSFFGAASQYWTSPTAGIYPNPSVPRHPNTHVPSHLGSYY 1F9A06C6893FE2AB erg_human Transcriptional regulator ERG ERG Transforming protein ERG protein protein human Homo sapiens Human MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY DIP protein P11308 original sequence version: 138 A5069C393E409483 rbtn2_human Rhombotin-2 LMO2 RBTN2 RHOM2 TTG2 LIM domain only protein 2 Cysteine-rich protein TTG-2 T-cell translocation protein 2 RBTNL1 protein protein human Homo sapiens Human MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI 1B4FF02505528C93 lmo2-erg 1 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey physical association physical association Fig. 7d lmo2-fli1 2 3 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7d