I2D I2D Requirement of the histone demethylase LSD1 in Snai1-mediated transcriptional repression during epithelial-mesenchymal transition. Requirement of the histone demethylase LSD1 in Snai1-mediated transcriptional repression during epithelial-mesenchymal transition. Oncogene (0950-9232) 2010 imex curation Lin T., Ponn A., Hu X., Law BK., Lu J. Cancer - Interactions investigated in the context of cancer Additional information from the author - we made several SNAG-GST constructs (with first 14, 22, 30, or 50 amino acids from human Snail or Slug), but only SNAG (50 aa from Snail)-GST resulted in sufficient protein yield for subsequent assays. In additional binding assays: SNAG (aa 1-14, or 1-22)-GST fusions failed to bind LSD1 in cell lysate in vitro. jrlu@ufl.edu 21-Dec-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lin T., Ponn A., Hu X., Law BK., Lu J. Cancer - Interactions investigated in the context of cancer Additional information from the author - we made several SNAG-GST constructs (with first 14, 22, 30, or 50 amino acids from human Snail or Slug), but only SNAG (50 aa from Snail)-GST resulted in sufficient protein yield for subsequent assays. In additional binding assays: SNAG (aa 1-14, or 1-22)-GST fusions failed to bind LSD1 in cell lysate in vitro. jrlu@ufl.edu Accepted 2010-OCT-16 by ORCHARD. 21-Dec-2010: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Requirement of the histone demethylase LSD1 in Snai1-mediated transcriptional repression during epithelial-mesenchymal transition. Requirement of the histone demethylase LSD1 in Snai1-mediated transcriptional repression during epithelial-mesenchymal transition. Oncogene (0950-9232) 2010 imex curation Lin T., Ponn A., Hu X., Law BK., Lu J. Cancer - Interactions investigated in the context of cancer Additional information from the author - we made several SNAG-GST constructs (with first 14, 22, 30, or 50 amino acids from human Snail or Slug), but only SNAG (50 aa from Snail)-GST resulted in sufficient protein yield for subsequent assays. In additional binding assays: SNAG (aa 1-14, or 1-22)-GST fusions failed to bind LSD1 in cell lysate in vitro. jrlu@ufl.edu 21-Dec-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lin T., Ponn A., Hu X., Law BK., Lu J. Cancer - Interactions investigated in the context of cancer Additional information from the author - we made several SNAG-GST constructs (with first 14, 22, 30, or 50 amino acids from human Snail or Slug), but only SNAG (50 aa from Snail)-GST resulted in sufficient protein yield for subsequent assays. In additional binding assays: SNAG (aa 1-14, or 1-22)-GST fusions failed to bind LSD1 in cell lysate in vitro. Additional information from the author - we made several SNAG-GST constructs (with first 14, 22, 30, or 50 amino acids from human Snail or Slug), but only SNAG (50 aa from Snail)-GST resulted in sufficient protein yield for subsequent assays. In additional binding assays: SNAG (aa 1-14, or 1-22)-GST fusions failed to bind LSD1 in cell lysate in vitro. jrlu@ufl.edu Accepted 2010-OCT-16 by ORCHARD. 21-Dec-2010: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Requirement of the histone demethylase LSD1 in Snai1-mediated transcriptional repression during epithelial-mesenchymal transition. Requirement of the histone demethylase LSD1 in Snai1-mediated transcriptional repression during epithelial-mesenchymal transition. Oncogene (0950-9232) 2010 imex curation Lin T., Ponn A., Hu X., Law BK., Lu J. Cancer - Interactions investigated in the context of cancer Additional information from the author - we made several SNAG-GST constructs (with first 14, 22, 30, or 50 amino acids from human Snail or Slug), but only SNAG (50 aa from Snail)-GST resulted in sufficient protein yield for subsequent assays. In additional binding assays: SNAG (aa 1-14, or 1-22)-GST fusions failed to bind LSD1 in cell lysate in vitro. jrlu@ufl.edu 21-Dec-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down autoradiography autoradiography Lin T., Ponn A., Hu X., Law BK., Lu J. Cancer - Interactions investigated in the context of cancer Additional information from the author - we made several SNAG-GST constructs (with first 14, 22, 30, or 50 amino acids from human Snail or Slug), but only SNAG (50 aa from Snail)-GST resulted in sufficient protein yield for subsequent assays. In additional binding assays: SNAG (aa 1-14, or 1-22)-GST fusions failed to bind LSD1 in cell lysate in vitro. Additional information from the author - we made several SNAG-GST constructs (with first 14, 22, 30, or 50 amino acids from human Snail or Slug), but only SNAG (50 aa from Snail)-GST resulted in sufficient protein yield for subsequent assays. In additional binding assays: SNAG (aa 1-14, or 1-22)-GST fusions failed to bind LSD1 in cell lysate in vitro. jrlu@ufl.edu Accepted 2010-OCT-16 by ORCHARD. 21-Dec-2010: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Requirement of the histone demethylase LSD1 in Snai1-mediated transcriptional repression during epithelial-mesenchymal transition. Requirement of the histone demethylase LSD1 in Snai1-mediated transcriptional repression during epithelial-mesenchymal transition. Oncogene (0950-9232) 2010 imex curation Lin T., Ponn A., Hu X., Law BK., Lu J. Cancer - Interactions investigated in the context of cancer Additional information from the author - we made several SNAG-GST constructs (with first 14, 22, 30, or 50 amino acids from human Snail or Slug), but only SNAG (50 aa from Snail)-GST resulted in sufficient protein yield for subsequent assays. In additional binding assays: SNAG (aa 1-14, or 1-22)-GST fusions failed to bind LSD1 in cell lysate in vitro. jrlu@ufl.edu 21-Dec-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lin T., Ponn A., Hu X., Law BK., Lu J. Cancer - Interactions investigated in the context of cancer Additional information from the author - we made several SNAG-GST constructs (with first 14, 22, 30, or 50 amino acids from human Snail or Slug), but only SNAG (50 aa from Snail)-GST resulted in sufficient protein yield for subsequent assays. In additional binding assays: SNAG (aa 1-14, or 1-22)-GST fusions failed to bind LSD1 in cell lysate in vitro. jrlu@ufl.edu Accepted 2010-OCT-16 by ORCHARD. 21-Dec-2010: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database rcor1_human REST corepressor 1 RCOR1 KIAA0071 RCOR Protein CoREST protein protein human Homo sapiens Human MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS DIP protein Q9UKL0 original sequence version: 132 DIP protein Q9UKL0 original sequence version: 126 DIP protein Q9UKL0 original sequence version: 115 DIP protein Q9UKL0 original sequence version: 91 DIP protein Q9UKL0 original sequence version: 144 DIP protein Q9UKL0 original sequence version: 80 77E90FB0EFD514B2 hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 kdm1a_human Lysine-specific histone demethylase 1A Flavin-containing amine oxidase domain-containing protein 2 BRAF35-HDAC complex protein BHC110 KDM1A KIAA0601 LSD1 AOF2 KDM1 [histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A protein protein human Homo sapiens Human MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTPRKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM A61CEDE51E4E0C1D snai1_human Zinc finger protein SNAI1 Protein snail homolog 1 SNAI1 SNAH protein protein human Homo sapiens Human MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR DIP protein O95863 original sequence version: 109 DIP protein O95863 original sequence version: 141 70E298C9BB154115 snai1-lsd1 2 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 6 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 5 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role bait bait carboxyl terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined snag domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Fig. 3b snai1-lsd1-1 3 8 unspecified role unspecified role bait bait carboxyl terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined snag domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey amino-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 3c,d snai1-lsd1-2 1 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O95863:p.Pro2Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:20:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro2ala' Tue Jun 30 17:16:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro2Ala' physical association physical association Fig. 3e snai1-lsd1-3 4 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 3f