IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis. GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis. Cancer Cell (1535-6108) 2010 imex curation Wang Z., Iwasaki M., Ficara F., Lin C., Matheny C., Wong SH., Smith KS., Cleary ML. Cancer - Interactions investigated in the context of cancer I take it from the authors reply: "All CREB and TORC1 construct were of human origin. We believe that HOXA9 and MEIS1 constructs were also human origin." - that they do not know/are not sure of the origin of the HOXA9 and MEIS1 constructs. Fig 5A cell line is stated to be Murine by authors - nothing given in the paper. Details of cell lines and constructs were supplied by authors; all CREB and TORC1 constructs were stated to be of human origin. The authors also believe that HOXA9 and MEIS1 constructs were of human origin. mcleary@stanford.edu 13-Sept-2010: Contacted by JYOTI. jyoti Only protein-protein interactions mouse-aml Mus musculus: Acute Myeloid Leukemia cells aml Acute myeloid leukemia cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang Z., Iwasaki M., Ficara F., Lin C., Matheny C., Wong SH., Smith KS., Cleary ML. Cancer - Interactions investigated in the context of cancer I take it from the authors reply: "All CREB and TORC1 construct were of human origin. We believe that HOXA9 and MEIS1 constructs were also human origin." - that they do not know/are not sure of the origin of the HOXA9 and MEIS1 constructs. Fig 5A cell line is stated to be Murine by authors - nothing given in the paper. I take it from the authors reply: "All CREB and TORC1 construct were of human origin. We believe that HOXA9 and MEIS1 constructs were also human origin." - that they do not know/are not sure of the origin of the HOXA9 and MEIS1 constructs. Fig 5A cell line is stated to be Murine by authors - nothing given in the paper. Details of cell lines and constructs were supplied by authors; all CREB and TORC1 constructs were stated to be of human origin. The authors also believe that HOXA9 and MEIS1 constructs were of human origin. mcleary@stanford.edu Accepted 2010-AUG-14 by JYOTI. 13-Sept-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis. GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis. Cancer Cell (1535-6108) 2010 imex curation Wang Z., Iwasaki M., Ficara F., Lin C., Matheny C., Wong SH., Smith KS., Cleary ML. Cancer - Interactions investigated in the context of cancer I take it from the authors reply: "All CREB and TORC1 construct were of human origin. We believe that HOXA9 and MEIS1 constructs were also human origin." - that they do not know/are not sure of the origin of the HOXA9 and MEIS1 constructs. Fig 5A cell line is stated to be Murine by authors - nothing given in the paper. Details of cell lines and constructs were supplied by authors; all CREB and TORC1 constructs were stated to be of human origin. The authors also believe that HOXA9 and MEIS1 constructs were of human origin. mcleary@stanford.edu 13-Sept-2010: Contacted by JYOTI. jyoti Only protein-protein interactions human-mv4-11 Human MV4-11, Acute Monocytic Leukemia cell line mv4-11 MV4-11 a human MLL leukemia cell line https://www.lgcstandards-atcc.org/Products/All/CRL-9591.aspx Human acute monocytic leukemia cell line. Described to carry a 4;11 translocation; MV4-11 carries an FLT3 internal tandem duplication. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang Z., Iwasaki M., Ficara F., Lin C., Matheny C., Wong SH., Smith KS., Cleary ML. Cancer - Interactions investigated in the context of cancer I take it from the authors reply: "All CREB and TORC1 construct were of human origin. We believe that HOXA9 and MEIS1 constructs were also human origin." - that they do not know/are not sure of the origin of the HOXA9 and MEIS1 constructs. Fig 5A cell line is stated to be Murine by authors - nothing given in the paper. Cell lysates were subjected to immunoprecipitation with anti-MEIS monoclonal antibody conjugated beads. Details of cell lines and constructs were supplied by authors; all CREB and TORC1 constructs were stated to be of human origin. The authors also believe that HOXA9 and MEIS1 constructs were of human origin. mcleary@stanford.edu Accepted 2010-AUG-14 by JYOTI. 13-Sept-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis. GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis. Cancer Cell (1535-6108) 2010 imex curation Wang Z., Iwasaki M., Ficara F., Lin C., Matheny C., Wong SH., Smith KS., Cleary ML. Cancer - Interactions investigated in the context of cancer I take it from the authors reply: "All CREB and TORC1 construct were of human origin. We believe that HOXA9 and MEIS1 constructs were also human origin." - that they do not know/are not sure of the origin of the HOXA9 and MEIS1 constructs. Fig 5A cell line is stated to be Murine by authors - nothing given in the paper. Details of cell lines and constructs were supplied by authors; all CREB and TORC1 constructs were stated to be of human origin. The authors also believe that HOXA9 and MEIS1 constructs were of human origin. mcleary@stanford.edu 13-Sept-2010: Contacted by JYOTI. jyoti Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang Z., Iwasaki M., Ficara F., Lin C., Matheny C., Wong SH., Smith KS., Cleary ML. Cancer - Interactions investigated in the context of cancer I take it from the authors reply: "All CREB and TORC1 construct were of human origin. We believe that HOXA9 and MEIS1 constructs were also human origin." - that they do not know/are not sure of the origin of the HOXA9 and MEIS1 constructs. Fig 5A cell line is stated to be Murine by authors - nothing given in the paper. Details of cell lines and constructs were supplied by authors; all CREB and TORC1 constructs were stated to be of human origin. The authors also believe that HOXA9 and MEIS1 constructs were of human origin. mcleary@stanford.edu Accepted 2010-AUG-14 by JYOTI. 13-Sept-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis. GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis. Cancer Cell (1535-6108) 2010 imex curation Wang Z., Iwasaki M., Ficara F., Lin C., Matheny C., Wong SH., Smith KS., Cleary ML. Cancer - Interactions investigated in the context of cancer I take it from the authors reply: "All CREB and TORC1 construct were of human origin. We believe that HOXA9 and MEIS1 constructs were also human origin." - that they do not know/are not sure of the origin of the HOXA9 and MEIS1 constructs. Fig 5A cell line is stated to be Murine by authors - nothing given in the paper. Details of cell lines and constructs were supplied by authors; all CREB and TORC1 constructs were stated to be of human origin. The authors also believe that HOXA9 and MEIS1 constructs were of human origin. mcleary@stanford.edu 13-Sept-2010: Contacted by JYOTI. jyoti Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang Z., Iwasaki M., Ficara F., Lin C., Matheny C., Wong SH., Smith KS., Cleary ML. Cancer - Interactions investigated in the context of cancer I take it from the authors reply: "All CREB and TORC1 construct were of human origin. We believe that HOXA9 and MEIS1 constructs were also human origin." - that they do not know/are not sure of the origin of the HOXA9 and MEIS1 constructs. Fig 5A cell line is stated to be Murine by authors - nothing given in the paper. Details of cell lines and constructs were supplied by authors; all CREB and TORC1 constructs were stated to be of human origin. The authors also believe that HOXA9 and MEIS1 constructs were of human origin. mcleary@stanford.edu Accepted 2010-AUG-14 by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis. GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis. Cancer Cell (1535-6108) 2010 imex curation Wang Z., Iwasaki M., Ficara F., Lin C., Matheny C., Wong SH., Smith KS., Cleary ML. Cancer - Interactions investigated in the context of cancer I take it from the authors reply: "All CREB and TORC1 construct were of human origin. We believe that HOXA9 and MEIS1 constructs were also human origin." - that they do not know/are not sure of the origin of the HOXA9 and MEIS1 constructs. Fig 5A cell line is stated to be Murine by authors - nothing given in the paper. Details of cell lines and constructs were supplied by authors; all CREB and TORC1 constructs were stated to be of human origin. The authors also believe that HOXA9 and MEIS1 constructs were of human origin. mcleary@stanford.edu 13-Sept-2010: Contacted by JYOTI. jyoti Only protein-protein interactions mouse-myeloid_progenitors Mouse myeloid progenitor cells myeloid_progenitor myeloid progenitor cell ES cell-derived ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Wang Z., Iwasaki M., Ficara F., Lin C., Matheny C., Wong SH., Smith KS., Cleary ML. Cancer - Interactions investigated in the context of cancer I take it from the authors reply: "All CREB and TORC1 construct were of human origin. We believe that HOXA9 and MEIS1 constructs were also human origin." - that they do not know/are not sure of the origin of the HOXA9 and MEIS1 constructs. Fig 5A cell line is stated to be Murine by authors - nothing given in the paper. HOXA9/MEIS1 transformed myeloid progenitors were used. Details of cell lines and constructs were supplied by authors; all CREB and TORC1 constructs were stated to be of human origin. The authors also believe that HOXA9 and MEIS1 constructs were of human origin. mcleary@stanford.edu Accepted 2010-AUG-14 by JYOTI. 13-Sept-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation fos_mouse_gene Mouse FOS gene gene gene mouse Mus musculus Mouse creb1_mouse Cyclic AMP-responsive element-binding protein 1 Creb1 Creb-1 protein protein mouse Mus musculus Mouse MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD 00D1F26B00D48442 meis1_human Homeobox protein Meis1 MEIS1 protein protein human Homo sapiens Human MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM 3B6A0ACCF0C39121 cbp_human CREB-binding protein CREBBP CBP Histone lysine acetyltransferase CREBBP Protein-lysine acetyltransferase CREBBP protein protein human Homo sapiens Human MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGKSPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPNGPLSLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMPQPPNMMGAHTNNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVEVKEEEESSSNGTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAGFPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNSMPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGLPRPVISMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQQGSAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL DIP protein Q92793 original sequence version: 134 DIP protein Q92793-1 original sequence version: 171 DIP protein Q92793 original sequence version: 171 DIP protein Q92793 original sequence version: 185 DIP protein Q92793 original sequence version: 106 DIP protein Q92793 original sequence version: 104 DIP protein Q92793 original sequence version: 112 DIP protein Q92793 original sequence version: 135 DIP protein Q92793 original sequence version: 139 DIP protein Q92793 original sequence version: 157 DIP protein Q92793 original sequence version: 177 DIP protein Q92793 original sequence version: 168 DIP protein Q92793-1 original sequence version: 174 DIP protein Q92793 original sequence version: 146 DIP protein Q92793 original sequence version: 161 DIP protein Q92793 original sequence version: 172 3BEA9B8558BA1A5E pbx1_human Pre-B-cell leukemia transcription factor 1 PBX1 PRL Homeobox protein PBX1 Homeobox protein PRL protein protein human Homo sapiens Human MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSVHSDTSN AD3FFACBC5A9E715 crtc1_human CREB-regulated transcription coactivator 1 CRTC1 KIAA0616 MECT1 TORC1 WAMTP1 Transducer of regulated cAMP response element-binding protein 1 Mucoepidermoid carcinoma translocated protein 1 protein protein human Homo sapiens Human MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARRQQASPTLSPLSPITQAVAMDALSLEQQLPYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPPPLAVTVPSSLPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYEQQMAARQANALSHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPNIILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL ECDC427FF9D6920B creb1_human Cyclic AMP-responsive element-binding protein 1 CREB1 protein protein human Homo sapiens Human MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD DIP protein P16220 original sequence version: 169 DIP protein P16220 original sequence version: 158 F5BA8200EE5184B7 meis1-creb 4 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5A. SB216763 - a GSK-3 inhibitor. Transfected exogenous CREB in 293T cells and endogenous CREB in (murine) AML cells transformed by HOXA9/MEIS1 coprecipitated with MEIS1. GSK-3 inhibitor treatment markedly reduced MEIS1-CREB coimmunoprecipitation, but not interaction of MEIS1 with its dimerization partner PBX1b. meis1-creb-1 1 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 5A. SB216763 - a GSK-3 inhibitor. Transfected exogenous CREB in 293T cells and endogenous CREB in (murine) AML cells transformed by HOXA9/MEIS1 coprecipitated with MEIS1. GSK-3 inhibitor treatment markedly reduced MEIS1-CREB coimmunoprecipitation, but not interaction of MEIS1 with its dimerization partner PBX1b. meis1-creb-2 2 8 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Fig 5B. SB216763 - a GSK-3 inhibitor. GSK3-dependent association of endogenous CREB and MEIS1 was observed in coprecipitation studies of the human MLL leukemia cell line MV411. meis1-creb-3 3 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P16220:p.Ser115Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:31:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser129ala' Tue Jun 30 16:50:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser129Ala' Thu Oct 29 21:40:07 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P16220:p.Ser129Ala' P16220:p.Ser119Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:43:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser133ala' Tue Jun 30 20:25:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser133Ala' Thu Oct 29 22:01:48 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P16220:p.Ser133Ala' 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 5C. SB216763 - a GSK-3 inhibitor. Transfected exogenous CREB in 293T cells coprecipitated with MEIS1, but CREB mutants S129A and S133A did not coimmunoprecipitate with MEIS1. I would have thought the 2 mutations sould be either "required to bind" or "mutation disrupting" - but the manual states (for HotSpot)it should be "mutation decreasing" (the manual does not contain the word "disrupting" - so when would one use "mutation disrupting"? meis1-creb-5 4 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5D. SB216763 - a GSK-3 inhibitor. MEIS1 also coprecipitated the CREB coactivators CBP and TORC, which was markedly reduced by GSK-3 inhibition. meis1-creb-6 3 11 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5E. SB216763 - a GSK-3 inhibitor. MEIS1 also coprecipitated the CREB coactivators CBP and TORC, which was markedly reduced by GSK-3 inhibition. creb1-cbp 4 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P16220:p.Ser115Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 20:04:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser129ala' Tue Jun 30 19:25:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser129Ala' Thu Oct 29 22:50:07 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P16220:p.Ser129Ala' P16220:p.Ser119Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:18:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser133ala' Tue Jun 30 17:13:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser133Ala' Thu Oct 29 22:13:53 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P16220:p.Ser133Ala' physical association physical association Fig 5F. SB216763 - a GSK-3 inhibitor. CBP coIP was dependent on the presence of CREB, and abrogated in the CREB phosphorylation mutants, or by GSK-3 inhibition. I would have thought the 2 mutations sould be either "required to bind" or "mutation disrupting" - but the manual states (for HotSpot)it should be "mutation decreasing" (the manual does not contain the word "disrupting" - so when would one use "mutation disrupting"? meis1-creb-7 4 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5H. MEIS1/CREB association depends on TORC2. No cell line is given - i am assuming it is 293T again. meis1-creb-8 3 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c terminal domain required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5I. No cell line is given - i am assuming it is 293T again. Deletion of the MEIS1 C terminus abrogates MEIS1 transcriptional activation and association with CREB. creb-fos 5 6 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association Fig 6D. SB216763 - a GSK-3 inhibitor. In HOXA9/MEIS1 transformed myeloid progenitors, chromatin IP of the FOS promoter showed MEIS1 and CREB occupancy, which was reduced by GSK-3 inhibition. meis1-fos 5 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey association association Fig 6D. SB216763 - a GSK-3 inhibitor. In HOXA9/MEIS1 transformed myeloid progenitors, chromatin IP of the FOS promoter showed MEIS1 and CREB occupancy, which was reduced by GSK-3 inhibition.