IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. Cancer Cell (1535-6108) 2010 imex curation Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn 25-Jun-2010: Contacted by JYOTI. Anti-RAR-alpha antibody used. orchard Only protein-protein interactions 7 human-u937_pr9 Homo sapiens U937-PR9 lymphoma cells expressing zinc-inducible PML-RAR alpha u937_pr9 U937-PR9 hematopoietic precursor cells expressing zinc-inducible PML-RAR alpha U937-PR9 cells, which are hematopoietic precursor cells carrying the PML-RARa coding sequence under the control of a zinc-inducible promoter. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn Accepted 2010-MAY-9 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Anti-RAR-alpha antibody used. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions 7 imex curation PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. Cancer Cell (1535-6108) 2010 imex curation Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn 25-Jun-2010: Contacted by JYOTI. Anti-RAR-alpha antibody used. orchard Only protein-protein interactions 7 human-nb4 Human NB4 APL cell line nb4 NB4 human acute promyelocytic leukemia cells Human acute promyelocytic leukemia established from the bone marrow of a 23- year-old woman with acute promyelocytic leukemia (APL = AML FAB M3) in second relapse in 1989; patented cell line; cells carry the t(15;17) PML-RARA fusion gene confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn Accepted 2010-MAY-9 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Anti-RAR-alpha antibody used. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions 7 imex curation PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. Cancer Cell (1535-6108) 2010 imex curation Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn 25-Jun-2010: Contacted by JYOTI. Anti-RAR-alpha antibody used. orchard Only protein-protein interactions 7 human-apl_blasts Homo sapiens APL (Acute Promyelocytic Leukaemia )blasts apl_blast cells APL (Acute Promyelocytic Leukaemia )blasts Bone marrow cells with > 85% abnormal blasts and promyelocytic cells. confocal microscopy confocal microscopy immunostaining immunostaining Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn Accepted 2010-MAY-9 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Anti-RAR-alpha antibody used. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions 7 imex curation PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. Cancer Cell (1535-6108) 2010 imex curation Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn 25-Jun-2010: Contacted by JYOTI. Anti-RAR-alpha antibody used. orchard Only protein-protein interactions 7 human-u937_pr9 Homo sapiens U937-PR9 lymphoma cells expressing zinc-inducible PML-RAR alpha u937_pr9 U937-PR9 hematopoietic precursor cells expressing zinc-inducible PML-RAR alpha U937-PR9 cells, which are hematopoietic precursor cells carrying the PML-RARa coding sequence under the control of a zinc-inducible promoter. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn Accepted 2010-MAY-9 by ORCHARD. Anti-RAR-alpha antibody used. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions 7 imex curation PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. Cancer Cell (1535-6108) 2010 imex curation Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn 25-Jun-2010: Contacted by JYOTI. Anti-RAR-alpha antibody used. orchard Only protein-protein interactions 7 human-nb4 Human NB4 APL cell line nb4 NB4 human acute promyelocytic leukemia cells Human acute promyelocytic leukemia established from the bone marrow of a 23- year-old woman with acute promyelocytic leukemia (APL = AML FAB M3) in second relapse in 1989; patented cell line; cells carry the t(15;17) PML-RARA fusion gene confirmed as human with IEF of AST, MDH confocal microscopy confocal microscopy immunostaining immunostaining Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn Accepted 2010-MAY-9 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Anti-RAR-alpha antibody used. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions 7 imex curation PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia. Cancer Cell (1535-6108) 2010 imex curation Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn 25-Jun-2010: Contacted by JYOTI. Anti-RAR-alpha antibody used. orchard Only protein-protein interactions 7 human-u937_pr9 Homo sapiens U937-PR9 lymphoma cells expressing zinc-inducible PML-RAR alpha u937_pr9 U937-PR9 hematopoietic precursor cells expressing zinc-inducible PML-RAR alpha U937-PR9 cells, which are hematopoietic precursor cells carrying the PML-RARa coding sequence under the control of a zinc-inducible promoter. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang K., Wang P., Shi J., Zhu X., He M., Jia X., Yang X., Qiu F., Jin W., Qian M., Fang H., Mi J., Yang X., Xiao H., Minden M., Du Y., Chen Z., Zhang J. Cancer - Interactions investigated in the context of cancer TrEMBL Q15156 (PML-RAR fusion protein)has been used as a reference entry only, as the exact sequence of the fusion protein is not known. Re-chIp assay using ZnSO4-treated PR9 cells. jizhang@sibs.ac.cn Accepted 2010-MAY-9 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Anti-RAR-alpha antibody used. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions 7 imex curation csf3r_human_gene PU.1-RAREh site gene gene human Homo sapiens Human ab1ip_human_gene Human PU.1-RAREh site gene gene human Homo sapiens Human spi1_human Transcription factor PU.1 SPI1 31 kDa-transforming protein protein protein human Homo sapiens Human MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH DIP protein P17947 original sequence version: 88 9592DAA1D85053ED creb1_human Cyclic AMP-responsive element-binding protein 1 CREB1 protein protein human Homo sapiens Human MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD DIP protein P16220 original sequence version: 169 DIP protein P16220 original sequence version: 158 F5BA8200EE5184B7 rarb_human_gene Human RARBeta gene gene gene human Homo sapiens Human fes_human_gene Human PU.1-RAREh site gene gene human Homo sapiens Human q15156_human PML-RAR protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP 8C16B6E85CBDD214 psb10_human_gene Proteasome subunit beta type-10 gene gene human Homo sapiens Human tnr18_human_gene Human PU.1-RAREh site gene gene human Homo sapiens Human rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT DIP protein P19793 original sequence version: 177 DIP protein P19793 original sequence version: 107 DIP protein P19793 original sequence version: 153 DIP protein P19793 original sequence version: 131 DIP protein P19793 original sequence version: 136 DIP protein P19793 original sequence version: 169 DIP protein P19793 original sequence version: 161 DIP protein P19793 original sequence version: 139 7F952B580AD84C42 crtc2_human CREB-regulated transcription coactivator 2 TORC2 Transducer of regulated cAMP response element-binding protein 2 CRTC2 protein protein human Homo sapiens Human MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRRYTRHIDSSPYSPAYLSPPPESSWRRTMAWGNFPAEKGQLFRLPSALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETAYPSLSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNPNLQASLSSPQPQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ DIP protein Q53ET0 original sequence version: 54 DIP protein Q53ET0 original sequence version: 1(def) DIP protein Q53ET0 original sequence version: 50 EE6C52E0ECDC1DF1 hck_human_gene PU.1-RAREh site gene gene human Homo sapiens Human spi1_human_gene Human Spi1 (PU.1) gene gene gene human Homo sapiens Human fril_human_gene Human PU.1-RAREh site gene gene human Homo sapiens Human meis1_human Homeobox protein Meis1 MEIS1 protein protein human Homo sapiens Human MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM 3B6A0ACCF0C39121 ab1ip 4 13 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B ab1ip-1 4 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B csf3r 4 13 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B csf3r-1 4 13 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B fes 4 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B fes-1 4 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B fril 4 13 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B fril-1 4 13 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B psb10 4 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B psb10-1 4 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B tnr1b 4 13 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B tnr1b-1 4 13 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B hck 4 13 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B hck-5 4 13 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Validation of the co-presence of PML/RARa and PU.1 on the same PU.1-RAREh regions. Regions immunoprecipitated with the first antibody were re-immunoprecipitated with the second antibody indicating the binding of PU.1 and PML/RARa to the same DNA. Fig 3B rara-pml-pu1 6 13 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association PML/RARa was specifically detected in immunoprecipitates obtained with the anti-PU.1 antibody, suggesting that an interaction between PML/RARa and PU.1 occurred in vivo. Fig 3D As illustrated in Figure 3D, PU.1 was specifically detected in protein products immunoprecipitated by either the anti-RARα or the anti-PML antibody (left panel) and, likewise, PML/RARα was specifically detected in immunoprecipitates obtained with the anti-PU.1 antibody (right panel), suggesting that an interaction between PML/RARα and PU.1 occurred in vivo. pml-rara-pu1 6 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association PML/RARa was specifically detected in immunoprecipitates obtained with the anti-PU.1 antibody, suggesting that an interaction between PML/RARa and PU.1 occurred in vivo. Fig 3D As illustrated in Figure 3D, PU.1 was specifically detected in protein products immunoprecipitated by either the anti-RARα or the anti-PML antibody (left panel) and, likewise, PML/RARα was specifically detected in immunoprecipitates obtained with the anti-PU.1 antibody (right panel), suggesting that an interaction between PML/RARα and PU.1 occurred in vivo. hck-rara 1 13 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey association association RXR was present in some, but not all, of the tested ChIP regions. Fig 5F fril-rara 1 13 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey association association RXR was present in some, but not all, of the tested ChIP regions. Fig 5F. rarb-rara 1 13 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association RXR was present in some, but not all, of the tested ChIP regions. Fig 5F. spi1-rara 1 13 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey association association RXR was present in some, but not all, of the tested ChIP regions. Fig 5F. hck-rxra 1 16 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey association association RXR was present in some, but not all, of the tested ChIP regions. Fig 5F fril-rxra 1 20 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association RXR was present in some, but not all, of the tested ChIP regions. Fig 5F. rarb-rxra-1 1 11 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association RXR was present in some, but not all, of the tested ChIP regions. Fig 5F. pml-spi1 2 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association PML/RARa was immunoprecipitated by the anti-PU.1 antibody and vice versa, demonstrating that PML/RARa interacts with PU.1 in NB4 cells - (a cell line expressing the PML/RARa fusion protein). Fig 6B spi1-rara-1 2 13 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association PML/RARa was immunoprecipitated by the anti-PU.1 antibody and vice versa, demonstrating that PML/RARa interacts with PU.1 in NB4 cells - (a cell line expressing the PML/RARa fusion protein). Fig 6B pml-spi1-1 5 13 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization PU.1 and PML/RARa colocalized on microspeckles. Fig 6C I cannot find a GO entry for "microspeckles" - presumably this just means "spots"! pml-spi1-2 3 13 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization PU.1 and PML/RARa colocalized on microspeckles. Fig 6C, S3. meis1-creb_torc 4 17 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5H. The MEIS1/CREB association depends on TORC. No cell line given - i assume it is 293T.