IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Increased radioresistance and accelerated B cell lymphomas in mice with Mdmx mutations that prevent modifications by DNA-damage-activated kinases. Increased radioresistance and accelerated B cell lymphomas in mice with Mdmx mutations that prevent modifications by DNA-damage-activated kinases. Cancer Cell (1535-6108) 2009 imex curation Wang YV., Leblanc M., Wade M., Jochemsen AG., Wahl GM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer NCS (neocarzinostatin, a radiomimetic agent) and proteosome inhibitor MG132. Additional detail of constructs supplied by the author. wahl@salk.edu 13-Sept-2010: Contacted by JYOTI. orchard Only protein-protein interactions 2 mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang YV., Leblanc M., Wade M., Jochemsen AG., Wahl GM. Apoptosis - Interactions involving proteins with a function related to apoptosis NCS (neocarzinostatin, a radiomimetic agent) and proteosome inhibitor MG132. Additional detail of constructs supplied by the author. wahl@salk.edu Accepted 2010-AUG-30 by ORCHARD. 13-Sept-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 2 imex curation Increased radioresistance and accelerated B cell lymphomas in mice with Mdmx mutations that prevent modifications by DNA-damage-activated kinases. Increased radioresistance and accelerated B cell lymphomas in mice with Mdmx mutations that prevent modifications by DNA-damage-activated kinases. Cancer Cell (1535-6108) 2009 imex curation Wang YV., Leblanc M., Wade M., Jochemsen AG., Wahl GM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer NCS (neocarzinostatin, a radiomimetic agent) and proteosome inhibitor MG132. Additional detail of constructs supplied by the author. wahl@salk.edu 13-Sept-2010: Contacted by JYOTI. orchard Only protein-protein interactions 2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wang YV., Leblanc M., Wade M., Jochemsen AG., Wahl GM. Apoptosis - Interactions involving proteins with a function related to apoptosis NCS (neocarzinostatin, a radiomimetic agent) and proteosome inhibitor MG132. Additional detail of constructs supplied by the author. wahl@salk.edu Accepted 2010-AUG-30 by ORCHARD. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 2 imex curation mdm4_mouse Protein Mdm4 Mdm4 Mdmx p53-binding protein Mdm4 Mdm2-like p53-binding protein Protein Mdmx Double minute 4 protein protein protein mouse Mus musculus Mouse MTSHSTSAQCSASDSACRISSEQISQVRPKLQLLKILHAAGAQGEVFTMKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGDLLGCQSFSVKDPSPLYDMLRKNLVTSASINTDAAQTLALAQDHTMDFPSQDRLKHGATEYSNPRKRTEEEDTHTLPTSRHKCRDSRADEDLIEHLSQDETSRLDLDFEEWDVAGLPWWFLGNLRNNCIPKSNGSTDLQTNQDIGTAIVSDTTDDLWFLNETVSEQLGVGIKVEAANSEQTSEVGKTSNKKTVEVGKDDDLEDSRSLSDDTDVELTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSNITAIPEKKDNEGIDVPDCRRTISAPVVRPKDGYLKEEKPRFDPCNSVGFLDLAHSSESQEIISSAREQTDIFSEQKAETESMEDFQNVLKPCSLCEKRPRDGNIIHGKTSHLTTCFHCARRLKKSGASCPACKKEIQLVIKVFIA 85A7602AA9AAFD52 1433e_rat 14-3-3 protein epsilon Ywhae Mitochondrial import stimulation factor L subunit protein protein rat Rattus norvegicus (Rat) Rat MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62260 original sequence version: 67 07817CCBD1F75B26 p53_mouse Cellular tumor antigen p53 Tp53 P53 Trp53 Tumor suppressor p53 protein protein mouse Mus musculus Mouse MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD DIP protein P02340 original sequence version: 117 DIP protein P02340 original sequence version: 165 DIP protein P02340 original sequence version: 187 DIP protein P02340 original sequence version: 201 DIP protein P02340 original sequence version: 111 DIP protein P02340 original sequence version: 141 DIP protein P02340 original sequence version: 180 DIP protein P02340 original sequence version: 163 DIP protein P02340 original sequence version: 152 ED5A607378D921D7 mdm2_mouse E3 ubiquitin-protein ligase Mdm2 p53-binding protein Mdm2 Oncoprotein Mdm2 Double minute 2 protein Mdm2 RING-type E3 ubiquitin transferase Mdm2 protein protein mouse Mus musculus Mouse MCNTNMSVSTEGAASTSQIPASEQETLVRPKPLLLKLLKSVGAQNDTYTMKEIIFYIGQYIMTKRLYDEKQQHIVYCSNDLLGDVFGVPSFSVKEHRKIYAMIYRNLVAVSQQDSGTSLSESRRQPEGGSDLKDPLQAPPEEKPSSSDLISRLSTSSRRRSISETEENTDELPGERHRKRRRSLSFDPSLGLCELREMCSGGSSSSSSSSSESTETPSHQDLDDGVSEHSGDCLDQDSVSDQFSVEFEVESLDSEDYSLSDEGHELSDEDDEVYRVTVYQTGESDTDSFEGDPEISLADYWKCTSCNEMNPPLPSHCKRCWTLRENWLPDDKGKDKVEISEKAKLENSAQAEEGLDVPDGKKLTENDAKEPCAEEDSEEKAEQTPLSQESDDYSQPSTSSSIVYSSQESVKELKEETQDKDESVESSFSLNAIEPCVICQGRPKNGCIVHGKTGHLMSCFTCAKKLKKRNKPCPVCRQPIQMIVLTYFN DIP protein P23804 original sequence version: 108 DIP protein P23804 original sequence version: 117 DIP protein P23804 original sequence version: 90 DIP protein P23804 original sequence version: 109 DIP protein P23804 original sequence version: 145 DIP protein P23804 original sequence version: 129 DIP protein P23804 original sequence version: 120 DIP protein P23804 original sequence version: 166 4ABF489A82038DF4 mdm4-ywhae 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined escherichia coli dh5[alpha] escherichia coli dh5[alpha] 3 unspecified role unspecified role prey prey mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. 3 unspecified role unspecified role prey prey O35618:p.[Ser341Ala;Ser367Ala;Ser402Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Fri Jul 22 10:54:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser367ala,ser402ala,ser341ala' Wed May 02 14:29:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser341ala,ser367ala,ser402ala' Tue Jun 30 16:44:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser341Ala;Ser367Ala;Ser402Ala]' physical association physical association MdmxWT bound to 14-3-3 when cells were treated with NCS. In the absence of NCS, a small portion of MdmxWT was also pulled down. Three highly conserved serine residues are targeted by the DNA-damage-activated kinases, but no interaction was detected with Mdmx3SA cells, which contain mutations at these conserved serine residues. Fig 3A. mdm4-mdm2 1 3 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey physical association physical association Three highly conserved serine residues are targeted by the DNA-damage-activated kinases. Similar amounts of Mdm2 were coimmunoprecipitated with MdmxWT and Mdmx3SA following DNA damage. Mdm2 was also coimmunoprecipitated with Mdmx3SA following treatment with the topoisomerase I inhibitor etoposide. Fig 3B, S4. I have not added the mutations as no difference is shown between mutant and WT.