IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Persistently activated Stat3 maintains constitutive NF-kappaB activity in tumors. Persistently activated Stat3 maintains constitutive NF-kappaB activity in tumors. Cancer Cell (1535-6108) 2009 imex curation Lee H., Herrmann A., Deng JH., Kujawski M., Niu G., Li Z., Forman S., Jove R., Pardoll DM., Yu H. Cancer - Interactions investigated in the context of cancer hyu@coh.org,dmpardol@jhmi.edu. 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions 6 mouse-b16 Mus musculus melanoma tumor maintained in mouse. b16 mouse skin melanoma tumor maintained in C57/B1 mouse pull down pull down western blot western blot Immuno blot Immuno blot Lee H., Herrmann A., Deng JH., Kujawski M., Niu G., Li Z., Forman S., Jove R., Pardoll DM., Yu H. Cancer - Interactions investigated in the context of cancer Authors contacted on 3/2/10 with regard to species of constructs in Figs (3) 4 + 5. hyu@coh.org,dmpardol@jhmi.edu. Accepted 2010-MAR-22 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 6 imex curation Persistently activated Stat3 maintains constitutive NF-kappaB activity in tumors. Persistently activated Stat3 maintains constitutive NF-kappaB activity in tumors. Cancer Cell (1535-6108) 2009 imex curation Lee H., Herrmann A., Deng JH., Kujawski M., Niu G., Li Z., Forman S., Jove R., Pardoll DM., Yu H. Cancer - Interactions investigated in the context of cancer hyu@coh.org,dmpardol@jhmi.edu. 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions 6 human-lung Human lung tissue lung confocal microscopy confocal microscopy immunostaining immunostaining Lee H., Herrmann A., Deng JH., Kujawski M., Niu G., Li Z., Forman S., Jove R., Pardoll DM., Yu H. Cancer - Interactions investigated in the context of cancer hyu@coh.org,dmpardol@jhmi.edu. Accepted 2010-MAR-22 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 6 imex curation Persistently activated Stat3 maintains constitutive NF-kappaB activity in tumors. Persistently activated Stat3 maintains constitutive NF-kappaB activity in tumors. Cancer Cell (1535-6108) 2009 imex curation Lee H., Herrmann A., Deng JH., Kujawski M., Niu G., Li Z., Forman S., Jove R., Pardoll DM., Yu H. Cancer - Interactions investigated in the context of cancer hyu@coh.org,dmpardol@jhmi.edu. 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions 6 human-a2058 Homo sapiens A2058: metastatic malignant melanoma cell line a2058 Human A2058 metastatic melanoma cell line confocal microscopy confocal microscopy immunostaining immunostaining Lee H., Herrmann A., Deng JH., Kujawski M., Niu G., Li Z., Forman S., Jove R., Pardoll DM., Yu H. Cancer - Interactions investigated in the context of cancer hyu@coh.org,dmpardol@jhmi.edu. Accepted 2010-MAR-22 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 6 imex curation Persistently activated Stat3 maintains constitutive NF-kappaB activity in tumors. Persistently activated Stat3 maintains constitutive NF-kappaB activity in tumors. Cancer Cell (1535-6108) 2009 imex curation Lee H., Herrmann A., Deng JH., Kujawski M., Niu G., Li Z., Forman S., Jove R., Pardoll DM., Yu H. Cancer - Interactions investigated in the context of cancer hyu@coh.org,dmpardol@jhmi.edu. 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions 6 human-a2058 Homo sapiens A2058: metastatic malignant melanoma cell line a2058 Human A2058 metastatic melanoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee H., Herrmann A., Deng JH., Kujawski M., Niu G., Li Z., Forman S., Jove R., Pardoll DM., Yu H. Cancer - Interactions investigated in the context of cancer email sent to author requesting further info 4/2/10. No reply received 16/02/10. EBI-2566861 and EBI-2566874 were "endogenous" and no info missing. EBI-2567416 - possibly OK. EBI-2567458 missing recombinant IKBA info ( possible kinase assay)but think the existing entry OK? NO IP added for Fig3B as species of origin of constructs unknown. (It IS an IP/WB - text says so, even if image legend does not.) Authors contacted on 3/2/10 with regard to species of constructs in Figs 3/4 + 5. hyu@coh.org,dmpardol@jhmi.edu. Accepted 2010-MAR-22 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 6 imex curation Persistently activated Stat3 maintains constitutive NF-kappaB activity in tumors. Persistently activated Stat3 maintains constitutive NF-kappaB activity in tumors. Cancer Cell (1535-6108) 2009 imex curation Lee H., Herrmann A., Deng JH., Kujawski M., Niu G., Li Z., Forman S., Jove R., Pardoll DM., Yu H. Cancer - Interactions investigated in the context of cancer hyu@coh.org,dmpardol@jhmi.edu. 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions 6 human-du_145 Homo sapiens DU-145 prostate cancer cell line du_145 DU-145 Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee H., Herrmann A., Deng JH., Kujawski M., Niu G., Li Z., Forman S., Jove R., Pardoll DM., Yu H. Cancer - Interactions investigated in the context of cancer hyu@coh.org,dmpardol@jhmi.edu. Accepted 2010-MAR-22 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 6 imex curation tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS DIP protein Q04207 original sequence version: 158 DIP protein Q04207 original sequence version: 117 DIP protein Q04207-1 original sequence version: 117 DIP protein Q04207-1 original sequence version: 118 DIP protein Q04207 original sequence version: 119 DIP protein Q04207 original sequence version: 141 DIP protein Q04207-1 original sequence version: 141 DIP protein Q04207-1 original sequence version: 149 DIP protein Q04207 original sequence version: 149 DIP protein Q04207 original sequence version: 168 DIP protein Q04207 original sequence version: 125 BDF1673D2FE398B9 stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D DIP protein P40763 original sequence version: 157 DIP protein P40763-1 original sequence version: 147 DIP protein P40763-1 original sequence version: 135 DIP protein P40763-1 original sequence version: 157 DIP protein P40763 original sequence version: 165 DIP protein P40763 original sequence version: 182 DIP protein P40763 original sequence version: 135 6C00632211C8012D biotin_probe_dna biotin-labeled oligonucleotide probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) GATCCATTAGGGGATGCCCCTCAT 075B3B40D73F93C1 ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL DIP protein P25963 original sequence version: 160 DIP protein P25963 original sequence version: 157 DIP protein P25963 original sequence version: 145 DIP protein P25963 original sequence version: 170 DIP protein P25963 original sequence version: 122 DIP protein P25963 original sequence version: 128 DIP protein P25963 original sequence version: 78 DIP protein P25963 original sequence version: 121 DIP protein P25963 original sequence version: 124 088B313226786395 tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 ikkb_human Inhibitor of nuclear factor kappa-B kinase subunit beta IKBKB IKKB I-kappa-B kinase 2 Nuclear factor NF-kappa-B inhibitor kinase beta Serine/threonine protein kinase IKBKB protein protein human Homo sapiens Human MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS DIP protein O14920 original sequence version: 89 DIP protein O14920 original sequence version: 100 DIP protein O14920 original sequence version: 121 DIP protein O14920 original sequence version: 126 DIP protein O14920 original sequence version: 136 DIP protein O14920 original sequence version: 128 DIP protein O14920-1 original sequence version: 151 DIP protein O14920 original sequence version: 142 DIP protein O14920 original sequence version: 159 DIP protein O14920 original sequence version: 93 DIP protein O14920 original sequence version: 124 DIP protein O14920-1 original sequence version: 178 DIP protein O14920 original sequence version: 85 F9CADF671AE9E14E kat2b_mouse Histone acetyltransferase KAT2B Pcaf Lysine acetyltransferase 2B Histone acetyltransferase PCAF Kat2b P300/CBP-associated factor Spermidine acetyltransferase KAT2B protein protein mouse Mus musculus Mouse MAEAGGAGSPALPPAPPHGSPRTLATAAGSSASCGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMDRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPSKERQTTIELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTKVFGRTLLRSVFTIMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSPLGIQTVISPPVTGTALFSSNSTSHEQINGGRTSPGCRGSSGLEANPGEKRKMNNSHAPEEAKRSRVMGDIPVELINEVMSTITDPAGMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPQIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPKDPEQLYSTLKNILQQVKNHPNAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLRNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCASILEKFFFSKIKEAGLIDK DIP protein Q9JHD1 original sequence version: 39 DIP protein Q9JHD1 original sequence version: 76 This sequence has been withdrawn from Uniprot. 38E52F326794F523 stat3_mouse Signal transducer and activator of transcription 3 Acute-phase response factor Stat3 Aprf protein protein mouse Mus musculus Mouse MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM DIP protein P42227 original sequence version: 169 DIP protein P42227 original sequence version: 162 DIP protein P42227 original sequence version: 164 DIP protein P42227 original sequence version: 141 6C00626711C8012D stat3-rela 3 7 unspecified role unspecified role neutral component neutral component region (possible) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region (possible) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 2A. Cellular localisation of p-Stat3 and pRelA was observed. stat3-rela-1 4 7 unspecified role unspecified role prey prey region (possible) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region (possible) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region (possible) naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2B, 3A. p-Stat3 and p-RelA also physically interacted with each other in A2058 cells (nuclear extracts) as demonstrated by immunoprecipitation with either anti-RelA or anti-Stat3 antibody. While Stat3 knockdown did not affect total levels of endogenous RelA protein, it reduced the relative amount of acetylated RelA. From looking at image 2B, I would have thought the bottom of the 2 IP images was carried out using DU145 cells, but the text says otherwise.(see source text annotation.) I have added the fig 3A info (acetylation) here. p-Stat3 and p-RelA also physically interacted with each other in A2058 cells (nuclear extracts) as demonstrated by immunoprecipitation with either anti-RelA or anti-Stat3 antibody. While Stat3 knockdown did not affect total levels of endogenous RelA protein, it reduced the relative amount of acetylated RelA. stat3-rela-2 4 7 unspecified role unspecified role bait bait region (possible) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region (possible) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2B. From looking at image 2B, I would have thought the bottom of the 2 IP images was carried out using DU145 cells, but the text says otherwise.(see source text annotation.) p-Stat3 and p-RelA also physically interacted with each other in A2058 cells as demonstrated by immunoprecipitation with either anti-RelA or anti-Stat3 antibody. stat3-rela-4 2 7 unspecified role unspecified role neutral component neutral component region (possible) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region (possible) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region (possible) ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 7, Supplementary Material Fig S4. Phospho-Stat3, acetylated RelA, and phospho-RelA were highly elevated in human tumor cells and that they colocalized well in the tumor cell nuclei. Nuclear colocalization of constitutively activated Stat3 and RelA is also observed in many other types of human tumors. Furthermore, there was little detectable phospho-Stat3, phospho-RelA, or acetylated RelA in nontransformed human tissues. stat3-rela-5 1 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey physical association physical association Fig 4B. Our results suggested Stat3, p300, and NF-kB were in the same DNA-binding complex in tumors (Figure 4B, upper right). stat3-ikkb-2 4 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Supplementary figure Fig S1B. ikba-ikkb-3 5 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Supplementary figure Fig S1B.