IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. Cancer Cell (1535-6108) 2008 imex curation Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg 09-April-2009: Contacted by JYOTI. davet Only protein-protein interactions 22 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Accepted 2008-Not a month!-15 by DAVET. 09-April-2009: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 davet Only protein-protein interactions 22 imex curation RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. Cancer Cell (1535-6108) 2008 imex curation Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg 09-April-2009: Contacted by JYOTI. davet Only protein-protein interactions 22 human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag immunost anti tag immunostaining anti tag immunost Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Accepted 2008-Not a month!-15 by DAVET. 09-April-2009: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 davet Only protein-protein interactions 22 imex curation RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. Cancer Cell (1535-6108) 2008 imex curation Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg 09-April-2009: Contacted by JYOTI. davet Only protein-protein interactions 22 human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Accepted 2008-Not a month!-15 by DAVET. 09-April-2009: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 davet Only protein-protein interactions 22 imex curation RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. Cancer Cell (1535-6108) 2008 imex curation Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg 09-April-2009: Contacted by JYOTI. davet Only protein-protein interactions 22 human-dld1 Human colorectal adenocarcinoma dld1 Human colon adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Accepted 2008-Not a month!-15 by DAVET. 09-April-2009: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 davet Only protein-protein interactions 22 imex curation RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. Cancer Cell (1535-6108) 2008 imex curation Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg 09-April-2009: Contacted by JYOTI. davet Only protein-protein interactions 22 human-colon human colon colon anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Accepted 2008-Not a month!-15 by DAVET. 09-April-2009: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 davet Only protein-protein interactions 22 imex curation RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. Cancer Cell (1535-6108) 2008 imex curation Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg 09-April-2009: Contacted by JYOTI. davet Only protein-protein interactions 22 human-sw620 Human caucasian colon adenocarcinoma SW620 cells sw620 Human caucasian colon adenocarcinoma SW620 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Accepted 2008-Not a month!-15 by DAVET. 09-April-2009: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 davet Only protein-protein interactions 22 imex curation RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. Cancer Cell (1535-6108) 2008 imex curation Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg 09-April-2009: Contacted by JYOTI. davet Only protein-protein interactions 22 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Untagged prey proteins identified by anti-bait antibodies Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Accepted 2008-Not a month!-15 by DAVET. 09-April-2009: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 davet Only protein-protein interactions 22 imex curation RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis. Cancer Cell (1535-6108) 2008 imex curation Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg 09-April-2009: Contacted by JYOTI. davet Only protein-protein interactions 22 human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ito K., Lim AC., Salto-Tellez M., Motoda L., Osato M., Chuang LS., Lee CW., Voon DC., Koo JK., Wang H., Fukamachi H., Ito Y. Cancer - Interactions investigated in the context of cancer Details on origin of constructs supplied by the author itoy@imcb.a-star.edu.sg Accepted 2008-Not a month!-15 by DAVET. 09-April-2009: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 davet Only protein-protein interactions 22 imex curation tf7l2_human Transcription factor 7-like 2 TCF7L2 TCF4 HMG box transcription factor 4 T-cell-specific transcription factor 4 protein protein human Homo sapiens Human MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE DIP protein Q9NQB0 original sequence version: 101 DIP protein Q9NQB0 original sequence version: 99 DIP protein Q9NQB0 original sequence version: 116 4DD2D3CC814AE16E ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E ccnd1_human_gene Human Cyclin D1 gene gene gene human Homo sapiens Human lef1_mouse Lymphoid enhancer-binding factor 1 Lef1 Lef-1 protein protein mouse Mus musculus Mouse MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVVRQAPSSQEPYHDKAREHPDEGKHPDGGLYNKGPSYSSYSGYIMMPNMNSDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPEIPTFYPLSPGGVGQITPPIGWQGQPVYPITGGFRQPYPSSLSGDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI DIP protein P27782 original sequence version: 88 DIP protein P27782-1 original sequence version: 103 0CA01B6C528FD7FA tcf7_human Transcription factor 7 TCF7 TCF1 T-cell-specific transcription factor 1 protein protein human Homo sapiens Human MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTETNWPRELKDGNGQESLSMSSSSSPA 5088C962F2FD0C00 runx3_human Runt-related transcription factor 3 RUNX3 AML2 CBFA3 PEBP2A3 Core-binding factor subunit alpha-3 Acute myeloid leukemia 2 protein Oncogene AML-2 Polyomavirus enhancer-binding protein 2 alpha C subunit SL3-3 enhancer factor 1 alpha C subunit SL3/AKV core-binding factor alpha C subunit protein protein human Homo sapiens Human MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY 593FBFB3C4639BBD tf7l1_mouse Transcription factor 7-like 1 HMG box transcription factor 3 Tcf7l1 Tcf3 protein protein mouse Mus musculus Mouse MPQLGGGRGGAGGGGGGSGAGATSGGDDLGANDELIPFQDEGGEEQEPSSDTASAQRDLDEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGGAYPGYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNDHFSPASPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAAPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHAQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQIQEAEGALASKSKKPCIQYLPPEKPCDSPASSHGSALDSPATPSAALASPAAPAATHSEQAQPLSLTTKPEARAQLALHSAAFLSAKAAASNSSQMGSQPPLLSRPLPLGSMPAALLTSPPTFPATLHAHQALPVLQAQPLSLVTKSAH DIP protein Q9Z1J1 original sequence version: 110 BA8B4F570AFC72CB myc_human_gene Human c-myc gene gene gene human Homo sapiens Human runx3-tcf7l2-1 2 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Exogenously expressed β-catenin, TCF4, and RUNX3 coimmunoprecipitate. Fig. 2B runx3-tcf7l2-2 2 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Exogenously expressed β-catenin, TCF4, and RUNX3 coimmunoprecipitate. Fig. 2B runx3-tcf7l2-3 2 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Exogenously expressed β-catenin, TCF4, and RUNX3 coimmunoprecipitate. Fig. 2B runx3-tcf7l2-4 7 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Ternary complex of exogenously expressed β-catenin/TCF4/RUNX3 detected by two-step coimmunoprecipitation. Fig. 2C, 2L runx3-tcf7l2-5 3 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association Endogenous ternary complex of β-catenin/TCF4/RUNX3 in HCT116 and SW620 cells Fig. 2D runx3-tcf7l2-6 6 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association Endogenous ternary complex of β-catenin/TCF4/RUNX3 in HCT116 and SW620 cells Fig. 2D runx3-tcf7l2-7 3 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association Endogenous ternary complex of β-catenin/TCF4/RUNX3 in HCT116 and SW620 cells Fig. 2D runx3-tcf7l2-8 3 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association Endogenous ternary complex of β-catenin/TCF4/RUNX3 in HCT116 and SW620 cells Fig. 2D runx3-tcf7l2-9 6 14 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association Endogenous ternary complex of β-catenin/TCF4/RUNX3 in HCT116 and SW620 cells Fig. 2D runx3-tcf7l2-10 6 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Endogenous ternary complex of β-catenin/TCF4/RUNX3 in HCT116 and SW620 cells Fig. 2D ctnnb1-tcf7l2-9 5 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 2D SW480 cells appear to express very low levels of RUNX3 - RUNX3 does appear in the complex if blots are over-exposed. ctnnb1-tcf7l2-10 5 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Fig. 2D SW480 cells appear to express very low levels of RUNX3 - RUNX3 does appear in the complex if blots are over-exposed. runx3-tcf7l2-11 1 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 14 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Interaction of in vitro-translated His-tagged RUNX3 with in vitro-translated Myc-TCF4 and/or HA-β-catenin as revealed by pull-down assays with Ni-NTA agarose. Fig. 2E runx3-tcf7l2-12 1 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 14 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Interactions between RUNX3 and TCF4 Fig. 2E runx3-ctnnb1-1 1 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 14 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association between RUNX3 and β-catenin were also observed in a cell-free system (Figure 2E). Fig. 2E runx3-ctnnb1-2 8 10 unspecified role unspecified role prey prey undefined mutation mutation increasing mutation increasing interaction mutation increasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:46:35 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'ser-45' P35222:p.Ser33Tyr mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S Y Wed May 02 17:08:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser33tyr' Tue Jun 30 16:11:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser33Tyr' 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Oncogenic β-catenins have a higher affinity for RUNX3 than wild-type β-catenin. Fig. 2F Oncogenic beta-catenins have a higher affinity for RUNX3 than wild-type beta-catenin. runx3-tcf7l2-13 7 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Interaction of RUNX3(R178Q) with β-catenin/TCF4 Fig. 2I Complex first purified by anti-flag co-immunoprecipitation then formation of ternary complex confirmed by a second round of coimmunoprecipitation with anti-myc antibodies. tcf7l2-ccnd1_gene 4 9 unspecified role unspecified role bait bait 14 competitor competitor competitor prey prey 11 unspecified role unspecified role prey prey association association Q13761 transfection However, when RUNX3 was stably expressed in DLD1 cells, β-catenin/TCF4 binding to either promoter was greatly reduced (Figure 3A, lanes 3 and 6, and Figure 3D Removal of RUNX3 by antisense treatment removed the inhibition of DNA binding by this protein Fig. 3A, 3B, 3C, 3D tcf7l2-myc_gene 4 14 competitor competitor competitor prey prey 16 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Q13761 transfection However, when RUNX3 was stably expressed in DLD1 cells, β-catenin/TCF4 binding to either promoter was greatly reduced (Figure 3A, lanes 3 and 6, and Figure 3D Removal of RUNX3 by antisense treatment removed the inhibition of DNA binding by this protein Fig. 3A, 3B, 3C, 3D ctnnb1-myc_gene 4 10 unspecified role unspecified role bait bait 14 competitor competitor competitor prey prey 16 unspecified role unspecified role prey prey association association Q13761 transfection However, when RUNX3 was stably expressed in DLD1 cells, β-catenin/TCF4 binding to either promoter was greatly reduced (Figure 3A, lanes 3 and 6, and Figure 3D Removal of RUNX3 by antisense treatment removed the inhibition of DNA binding by this protein Fig. 3A, 3B, 3D ctnnb1-ccnd1_gene 4 11 unspecified role unspecified role prey prey 14 competitor competitor competitor prey prey 10 unspecified role unspecified role bait bait association association Q13761 transfection However, when RUNX3 was stably expressed in DLD1 cells, β-catenin/TCF4 binding to either promoter was greatly reduced (Figure 3A, lanes 3 and 6, and Figure 3D Removal of RUNX3 by antisense treatment removed the inhibition of DNA binding by this protein Fig. 3A, 3B, 3D runx3-tcf7l2-14 2 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined runt region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association HCT116 cells were transfected with Flag-tagged RUNX3 derivatives and Myc-tagged full-length TCF4. Supp. Fig. S2A runx3-tcf7l2-15 2 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Mapping of the TCF4 domain that interacts with RUNX3. Supp. Fig. S2B runx3-tcf7l1-1 2 15 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Interaction between RUNX3 and TCFs (TCF1, Lef1, and TCF3). Supp. Fig. S2C runx3-tcf7-1 2 13 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Interaction between RUNX3 and TCFs (TCF1, Lef1, and TCF3). Supp. Fig. S2C runx3-lef1-1 2 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey physical association physical association Interaction between RUNX3 and TCFs (TCF1, Lef1, and TCF3). Supp. Fig. S2C