IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human Spot 14 protein is a p53-dependent transcriptional coactivator via the recruitment of thyroid receptor and Zac1. Human Spot 14 protein is a p53-dependent transcriptional coactivator via the recruitment of thyroid receptor and Zac1. Int. J. Biochem. Cell Biol. (1357-2725) 2008 imex curation Chou WY., Ho CL., Tseng ML., Liu ST., Yen LC., Huang SM. Cancer - Interactions investigated in the context of cancer shihming@ndmctsgh.edu.tw 25-Jun-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Chou WY., Ho CL., Tseng ML., Liu ST., Yen LC., Huang SM. Cancer - Interactions investigated in the context of cancer shihming@ndmctsgh.edu.tw Accepted 2008-JUN-6 by ORCHARD. Int. J. Biochem. Cell Biol. (1357-2725) 2008 orchard Only protein-protein interactions imex curation q9jlq4_mouse Plagl1 Zac1 protein protein mouse Mus musculus Mouse MAPFRCQKCGKSFVTLEKFTIHNYSHSRERPFKCSKAECGKAFVSKYKLMRHMATHSPQKIHQCTHCEKTFNRKDHLKNHLQTHDPNKISYACDDCGKKYHTMLGYKRHLALHSASNGDLTCGVCTLELGSTEVLLDHLKSHAEEKANQAPREKKYQCDHCDRCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMQENMQAGDYQSNFQLIAPSTSFQIKVDPMPPFQLGAAPENGLDGGLPPEVHGLVLAAPEEAPQPMPPLEPLEPLEPLEPLEPMQSLEPLQPLEPMQPLEPMQPLEPMQPLEPLEPLEPMQPLEPMQPLEPMQPMLPMQPMQPMQPMQPMLPMQPMLPMQPMQPMQPMLPMPEPSFTLHPGVVPTSPPPIILQEHKYNPVPTSYAPFVGMPVKADGKAFCNVGFFEEFPLQEPQAPLKFNPCFEMPMEGFGKVTLSKELLVDAVNIAIPASLEISSLLGFWQLPPPTPQNGFVNSTIPVGPGEPLPHRITCLAQQQPPPLPPPPPLPLPQPLPVPQPLPQPQMQPQFQLQIQPQMQPQMQLQPLQLQLPQLLPQLQPQQQPDPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEEEQEEAEEEAEEGAEEGAEPEAQAEEEEEEEEAEEPQPEEAQIAVSAVNLGQPPLPPTPHIFTAGSNTAILPHFHHAFR 3AF88262D504FA80 thrsp_human Thyroid hormone-inducible hepatic protein THRSP Spot 14 protein protein protein human Homo sapiens Human MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW 5135FB8EE380DF8F thrsp-plagl1 1 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 7 A The results of a GST pull-down assay demonstrated that hS14 protein does not directly physically interact with p53, but does directly interact with the p53 coactivator, Zac1