IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ LZAP, a putative tumor suppressor, selectively inhibits NF-kappaB. LZAP, a putative tumor suppressor, selectively inhibits NF-kappaB. Cancer Cell (1535-6108) 2007 imex curation Wang J., An H., Mayo MW., Baldwin AS., Yarbrough WG. Cancer - Interactions investigated in the context of cancer wendell.yarbrough@vanderbilt.edu 01-Feb-2008: Contacted by JYOTI. orchard Only protein-protein interactions 4 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wang J., An H., Mayo MW., Baldwin AS., Yarbrough WG. Cancer - Interactions investigated in the context of cancer wendell.yarbrough@vanderbilt.edu Accepted 2008-FEB-8 by ORCHARD. 01-Feb-2008: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 orchard Only protein-protein interactions 4 imex curation LZAP, a putative tumor suppressor, selectively inhibits NF-kappaB. LZAP, a putative tumor suppressor, selectively inhibits NF-kappaB. Cancer Cell (1535-6108) 2007 imex curation Wang J., An H., Mayo MW., Baldwin AS., Yarbrough WG. Cancer - Interactions investigated in the context of cancer wendell.yarbrough@vanderbilt.edu 01-Feb-2008: Contacted by JYOTI. orchard Only protein-protein interactions 4 human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang J., An H., Mayo MW., Baldwin AS., Yarbrough WG. Cancer - Interactions investigated in the context of cancer wendell.yarbrough@vanderbilt.edu Accepted 2008-FEB-8 by ORCHARD. 01-Feb-2008: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 orchard Only protein-protein interactions 4 imex curation LZAP, a putative tumor suppressor, selectively inhibits NF-kappaB. LZAP, a putative tumor suppressor, selectively inhibits NF-kappaB. Cancer Cell (1535-6108) 2007 imex curation Wang J., An H., Mayo MW., Baldwin AS., Yarbrough WG. Cancer - Interactions investigated in the context of cancer wendell.yarbrough@vanderbilt.edu 01-Feb-2008: Contacted by JYOTI. orchard Only protein-protein interactions 4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang J., An H., Mayo MW., Baldwin AS., Yarbrough WG. Cancer - Interactions investigated in the context of cancer wendell.yarbrough@vanderbilt.edu Accepted 2008-FEB-8 by ORCHARD. 01-Feb-2008: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 orchard Only protein-protein interactions 4 imex curation ck5p3_human CDK5 regulatory subunit-associated protein 3 CDK5 activator-binding protein C53 Protein HSF-27 CDK5RAP3 IC53 MSTP016 OK/SW-cl.114 PP1553 LXXLL/leucine-zipper-containing ARF-binding protein LZAP protein protein human Homo sapiens Human MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL A21E59A79E1F87E0 tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 cdk5rap3-rela 2 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 5 A, 5 D When coexpressed, LZAP was readily detected from RelA immunoprecipitates and RelA was reciprocally coprecipitated using LZAP antibody Q04206; Q96JB5 transfection rela-cdk5rap3 2 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 A When coexpressed, LZAP was readily detected from RelA immunoprecipitates and RelA was reciprocally coprecipitated using LZAP antibody Q04206; Q96JB5 transfection cdk5rap3-rela-1 3 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 5 C RelA was detected in immunoprecipitates prepared from untransfected 293T cells using an anti-LZAP serum but not in precipitates using a preimmune rabbit serum cdk5rap3-rela-2 1 4 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association 5 E LZAP interacted with full-length RelA, and RelA truncation mutants containing aa 195-313 and aa 195-350, but not with aa 250-350