IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. Cancer Cell (1535-6108) 2007 imex curation Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es 07-Sept-2007: Contacted by JYOTI. orchard Only protein-protein interactions 17 human-hl_60 Homo sapiens acute myeloid leukemia cell line hl_60 human acute myeloid leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es Accepted 2007-JUL-22 by ORCHARD. 07-Sept-2007: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 orchard Only protein-protein interactions 17 imex curation Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. Cancer Cell (1535-6108) 2007 imex curation Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es 07-Sept-2007: Contacted by JYOTI. orchard Only protein-protein interactions 17 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis I have not curated HMT activity assays as not clear which interactor acting as enzyme and species of origin of H3 not specified. This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es Accepted 2007-JUL-22 by ORCHARD. 07-Sept-2007: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 orchard Only protein-protein interactions 17 imex curation Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. Cancer Cell (1535-6108) 2007 imex curation Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es 07-Sept-2007: Contacted by JYOTI. orchard Only protein-protein interactions 17 human-u937_pr9 Homo sapiens U937-PR9 lymphoma cells expressing zinc-inducible PML-RAR alpha u937_pr9 U937-PR9 hematopoietic precursor cells expressing zinc-inducible PML-RAR alpha U937-PR9 cells, which are hematopoietic precursor cells carrying the PML-RARa coding sequence under the control of a zinc-inducible promoter. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis U937-PR9 cells express PML-RAR alpha under the control of a zinc-inducible promoter. Cells were treated with zinc or untreated. This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es Accepted 2007-JUL-22 by ORCHARD. 07-Sept-2007: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 orchard Only protein-protein interactions 17 imex curation Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. Cancer Cell (1535-6108) 2007 imex curation Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es 07-Sept-2007: Contacted by JYOTI. orchard Only protein-protein interactions 17 human-nb4 Human NB4 APL cell line nb4 NB4 human acute promyelocytic leukemia cells Human acute promyelocytic leukemia established from the bone marrow of a 23- year-old woman with acute promyelocytic leukemia (APL = AML FAB M3) in second relapse in 1989; patented cell line; cells carry the t(15;17) PML-RARA fusion gene confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es Accepted 2007-JUL-22 by ORCHARD. 07-Sept-2007: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 orchard Only protein-protein interactions 17 imex curation Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. Cancer Cell (1535-6108) 2007 imex curation Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es 07-Sept-2007: Contacted by JYOTI. orchard Only protein-protein interactions 17 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es Accepted 2007-JUL-22 by ORCHARD. 07-Sept-2007: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 orchard Only protein-protein interactions 17 imex curation Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. Cancer Cell (1535-6108) 2007 imex curation Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es 07-Sept-2007: Contacted by JYOTI. orchard Only protein-protein interactions 17 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es Accepted 2007-JUL-22 by ORCHARD. 07-Sept-2007: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 orchard Only protein-protein interactions 17 imex curation tp53_rara_human_protein p53-RAR alpha fusion protein protein protein human Homo sapiens Human DGEYFTLQIRGRERFEMFRELNEALELKDAQAMASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP An amino acid sequence which is not represented in UniProt The p53 tetramerization domain is fused to RAR alpha to induce oligomerization of RAR alpha. 99E0950B594C050C q15156_human PML-RAR protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP 8C16B6E85CBDD214 suz12_human Polycomb protein SUZ12 CHET9 JJAZ1 KIAA0160 SUZ12 Suppressor of zeste 12 protein homolog Joined to JAZF1 protein Chromatin precipitated E2F target 9 protein protein protein human Homo sapiens Human MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL DIP protein Q15022 original sequence version: 92 DIP protein Q15022 original sequence version: 88 DIP protein Q15022 original sequence version: 91 DIP protein Q15022 original sequence version: 106 A8830EBC3FD38D56 rara_human Retinoic acid receptor alpha RARA NR1B1 Nuclear receptor subfamily 1 group B member 1 protein protein human Homo sapiens Human MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP DIP protein P10276 original sequence version: 190 DIP protein P10276 original sequence version: 118 DIP protein P10276 original sequence version: 162 DIP protein P10276-1 original sequence version: 143 DIP protein P10276 original sequence version: 200 DIP protein P10276-1 original sequence version: 152 E8D1CF9A1E57CB99 pml_human Protein PML PML MYL RNF71 TRIM19 Tripartite motif-containing protein 19 RING finger protein 71 Promyelocytic leukemia protein PP8675 E3 SUMO-protein ligase PML RING-type E3 SUMO transferase PML protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS DIP protein P29590 original sequence version: 188 DIP protein P29590 original sequence version: 195 DIP protein P29590-1 original sequence version: 187 D50968A977E34287 eed_human Polycomb protein EED EED WD protein associating with integrin cytoplasmic tails 1 Embryonic ectoderm development protein protein protein human Homo sapiens Human MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR DIP protein O75530 original sequence version: 70 DIP protein O75530-1 original sequence version: 78 DIP protein O75530 original sequence version: 78 DIP protein O75530 original sequence version: 73 DIP protein O75530-1 original sequence version: 89 DIP protein O75530-1 original sequence version: 87 DIP protein O75530 original sequence version: 77 D2E0A5BA27C0499A ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP DIP protein Q15910 original sequence version: 97 DIP protein Q15910 original sequence version: 94 DIP protein Q15910 original sequence version: 92 DIP protein Q15910 original sequence version: 96 DIP protein Q15910 original sequence version: 122 DIP protein Q15910 original sequence version: 100 1B5029EB9D509BE5 q15156-ezh2 4 13 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 1 A Immunoblot analysis of anti-PML-RARa immunoprecipitates revealed the existence of endogenous complexes of PML-RARa with SUZ12, EZH2, and EED q15156-eed 4 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 1 A Immunoblot analysis of anti-PML-RARa immunoprecipitates revealed the existence of endogenous complexes of PML-RARa with SUZ12, EZH2, and EED q15156-suz12 4 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 1 A Immunoblot analysis of anti-PML-RARa immunoprecipitates revealed the existence of endogenous complexes of PML-RARa with SUZ12, EZH2, and EED q15156-suz12-1 3 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 1 B RAR alpha did not coimmunoprecipitate SUZ12 in cells not treated with zinc. ezh2-q15156 3 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 1 B EZH2 did not coimmunoprecipitate RAR alpha in cells not treated with zinc. q15156-eed-1 2 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 1 C; S2 A we transiently transfected 293T cells with expression vectors for Flag-tagged PML-RARa and the trimeric PRC2 complex (EED/EZH2/SUZ12) (Cao and Zhang, 2004a; Pasini et al., 2004). We found that all PRC2 components could be specifically immunoprecipitated with PML-RARa, using the anti-Flag antibody Q15156; Q15022; Q15910; O75530 transfection rara-ezh2 5 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 1 D P10276 transfection q15156-ezh2-1 5 13 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 1 D, S1 C Q15156; Q15910 transfection We found that the PML-RARa AHT mutant retains the capability to interact with EZH2 PML-RAR alpha AHT (A529G, H530G, T533A) retains the capability to bind EZH2. tp53_rara-ezh2 5 13 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 1 D P04637 transfection pml-ezh2 5 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association 1 E P29590 transfection Cells were transfected with either EZH2 or SUZ12 expression vectors. q15156-ezh2-2 6 8 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S1 A Q15156; Q15910 transfection ezh2-q15156-1 2 13 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey physical association physical association S1 A Q15156; Q15910 transfection suz12-q15156 5 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association S1 B Q15022; Q15156 transfection q15156-suz12-2 5 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association S1 B Q15022; Q15156 transfection rara-ezh2-1 1 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association S1 D q15156-ezh2-3 2 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association S3 A, D Q15156; Q15910 transfection The presence of SUZ12 is required for the PML-RAR/EZH2 interaction. q15156-ezh2-4 2 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S3 B Q15156 transfection