IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Oncogenic activation of c-Abl in non-small cell lung cancer cells lacking FUS1 expression: inhibition of c-Abl by the tumor suppressor gene product Fus1. Oncogenic activation of c-Abl in non-small cell lung cancer cells lacking FUS1 expression: inhibition of c-Abl by the tumor suppressor gene product Fus1. Oncogene (0950-9232) 2007 imex curation Lin J., Sun T., Ji L., Deng W., Roth J., Minna J., Arlinghaus R. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Please look at Fig 1 D more carefully and you will se that GST-Crk is not involved. For 1 a - c GST -Crk is involved. I wrote to the authors at the beginning of Dec to request the specieis of origin of GST-Crk and they have not replied so I have added data-processing comment to show these experiments cannot be curated. Please check all this. Abl used in experiments shown in Fig.1 is described in New England Biolabs catalog no P6050L/S. The range was identified from the UniProtKb entry P00521 in which the ranges for the SH2 and kinase domains are given. The full-length human Abl used is described in the Upstate website and the Genbank identifier U07563 given was used to find the corresponding UniProtKB Ac No. A unique UniProtKB entry could not be associated with CRK since the organism of origin of this interactor could not be ascertained. rarlingh@mdanderson.org 01-April-2008: Contacted by JYOTI. DAVET Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Lin J., Sun T., Ji L., Deng W., Roth J., Minna J., Arlinghaus R. Apoptosis - Interactions involving proteins with a function related to apoptosis Please look at Fig 1 D more carefully and you will se that GST-Crk is not involved. For 1 a - c GST -Crk is involved. I wrote to the authors at the beginning of Dec to request the specieis of origin of GST-Crk and they have not replied so I have added data-processing comment to show these experiments cannot be curated. Please check all this. A unique UniProtKB entry could not be associated with Crk since the organism of this interactor could not be ascertained. Abl used in experiments shown in Fig.1 is described in New England Biolabs catalog no P6050L/S. The range was identified from the UniProtKb entry P00521 in which the ranges for the SH2 and kinase domains are given. The full-length human Abl used is described in the Upstate website and the Genbank identifier U07563 given was used to find the corresponding UniProtKB Ac No. A unique UniProtKB entry could not be associated with CRK since the organism of origin of this interactor could not be ascertained. rarlingh@mdanderson.org Accepted 2008-MAR-1 by DAVET. 01-April-2008: Contacted by JYOTI. Oncogene (0950-9232) 2007 DAVET Only protein-protein interactions imex curation tusc2_human Tumor suppressor candidate 2 PDGFA-associated protein 2 Fusion 1 protein TUSC2 FUS1 LGCC PDAP2 C3orf11 protein protein human Homo sapiens Human MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV 9503BD10637C1504 abl_mlvab Tyrosine-protein kinase transforming protein Abl ABL V-abl protein protein mlvab Abelson murine leukemia virus YITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKRGTRGGAGSMLQAPELPTKTRTCRRAAEQKASPPSLTPKLLRRQVTASPSSGLSHKKEATKGSASGMGTPATAEPAPPSNKVGLSKASSEEMRVRRHKHSSESPGRDKGRLAKLKPAPPPPPACTGKAGKPAQSPSQEAGEAGGPTKTKCTSLAMDAVNTDPTKAGPPGEGLRKPVPPSVPKPQSTAKPPGTPTSPVSTPSTAPAPSPLAGDQQPSSAAFIPLISTRVSLRKTRQPPERIASGTITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISDIVRR B9072FFF55FE9257 abl-tide ABL-TIDE peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) EAIYAAPFAKKK abl1_human Tyrosine-protein kinase ABL1 Abelson tyrosine-protein kinase 1 ABL1 ABL JTK7 Abelson murine leukemia viral oncogene homolog 1 Proto-oncogene c-Abl p150 protein protein human Homo sapiens Human MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR DIP protein P00519 original sequence version: 114 DIP protein P00519 original sequence version: 137 DIP protein P00519 original sequence version: 161 DIP protein P00519 original sequence version: 220 DIP protein P00519 original sequence version: 219 85FE6C1C0E483EA2 abl-tusc2 1 3 enzyme enzyme unspecified role unspecified role region SH2 domain and kinase domain sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) 2 inhibitor inhibitor unspecified role unspecified role n-terminal stearate N-terminal moiety lipoconjugated residue lipoconjugated residue n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction 1 A Stearic acid-modified Fus1 peptide inhibits GST-Crk phosphorylation by a bacterially purified, constitutively active, Abl kinase The substrate of Abl kinase in this assay is GST-CRK. The Fus1 peptide was modified with a stearate N-terminal moiety. The Fus1 peptide lacking the stearate N-terminal moiety did not inhibit Abl kinase activity. Stearate-Fus1 peptide - The peptide inhibits Abl activity and inhibition increases as the concentration of peptide is increased. IC50 = 3.5 E-5 M abl1-c_abl_target_pe 1 5 enzyme enzyme self self 4 enzyme target enzyme target substrate substrate unspecified role unspecified role 2 inhibitor inhibitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal stearate N-terminal moiety lipoconjugated residue lipoconjugated residue n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction 1 D Stearic acid-modified Fus1 peptide inhibits target peptide phosphorylation by full-length human Abl kinase The Fus1 peptide was modified with a stearate N-terminal moiety. The Fus1 peptide lacking the stearate N-terminal moiety did not inhibit Abl kinase activity. Stearate-Fus1 peptide - The peptide inhibits Abl activity and inhibition increases as the concentration of peptide is increased.