IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Fez1/Lzts1 absence impairs Cdk1/Cdc25C interaction during mitosis and predisposes mice to cancer development. Fez1/Lzts1 absence impairs Cdk1/Cdc25C interaction during mitosis and predisposes mice to cancer development. Cancer Cell (1535-6108) 2007 imex curation Vecchione A., Baldassarre G., Ishii H., Nicoloso MS., Belletti B., Petrocca F., Zanesi N., Fong LY., Battista S., Guarnieri D., Baffa R., Alder H., Farber JL., Donovan PJ., Croce CM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer carlo.croce@osumc.edu 26-APR-2007: Contacted by JYOTI. Only protein-protein interactions 4 mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Vecchione A., Baldassarre G., Ishii H., Nicoloso MS., Belletti B., Petrocca F., Zanesi N., Fong LY., Battista S., Guarnieri D., Baffa R., Alder H., Farber JL., Donovan PJ., Croce CM. Apoptosis - Interactions involving proteins with a function related to apoptosis carlo.croce@osumc.edu Accepted 2007-MAY-10 by JYOTI. 26-APR-2007: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 Only protein-protein interactions 4 imex curation Fez1/Lzts1 absence impairs Cdk1/Cdc25C interaction during mitosis and predisposes mice to cancer development. Fez1/Lzts1 absence impairs Cdk1/Cdc25C interaction during mitosis and predisposes mice to cancer development. Cancer Cell (1535-6108) 2007 imex curation Vecchione A., Baldassarre G., Ishii H., Nicoloso MS., Belletti B., Petrocca F., Zanesi N., Fong LY., Battista S., Guarnieri D., Baffa R., Alder H., Farber JL., Donovan PJ., Croce CM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer carlo.croce@osumc.edu 26-APR-2007: Contacted by JYOTI. Only protein-protein interactions 4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Vecchione A., Baldassarre G., Ishii H., Nicoloso MS., Belletti B., Petrocca F., Zanesi N., Fong LY., Battista S., Guarnieri D., Baffa R., Alder H., Farber JL., Donovan PJ., Croce CM. Apoptosis - Interactions involving proteins with a function related to apoptosis carlo.croce@osumc.edu Accepted 2007-MAY-10 by JYOTI. 26-APR-2007: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 Only protein-protein interactions 4 imex curation Fez1/Lzts1 absence impairs Cdk1/Cdc25C interaction during mitosis and predisposes mice to cancer development. Fez1/Lzts1 absence impairs Cdk1/Cdc25C interaction during mitosis and predisposes mice to cancer development. Cancer Cell (1535-6108) 2007 imex curation Vecchione A., Baldassarre G., Ishii H., Nicoloso MS., Belletti B., Petrocca F., Zanesi N., Fong LY., Battista S., Guarnieri D., Baffa R., Alder H., Farber JL., Donovan PJ., Croce CM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer carlo.croce@osumc.edu 26-APR-2007: Contacted by JYOTI. Only protein-protein interactions 4 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Vecchione A., Baldassarre G., Ishii H., Nicoloso MS., Belletti B., Petrocca F., Zanesi N., Fong LY., Battista S., Guarnieri D., Baffa R., Alder H., Farber JL., Donovan PJ., Croce CM. Apoptosis - Interactions involving proteins with a function related to apoptosis carlo.croce@osumc.edu Accepted 2007-MAY-10 by JYOTI. 26-APR-2007: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 Only protein-protein interactions 4 imex curation cdk1_mouse Cyclin-dependent kinase 1 p34 protein kinase Cell division protein kinase 1 Cdk1 Cdc2a Cdc2 Cell division control protein 2 homolog Cdkn1 protein protein mouse Mus musculus Mouse MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLHQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDDLDNQIKKM DIP protein P11440 original sequence version: 149 DIP protein P11440 original sequence version: 164 9C399FCC41BA7F31 mpip3_human M-phase inducer phosphatase 3 CDC25C Dual specificity phosphatase Cdc25C protein protein human Homo sapiens Human MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP DIP protein P30307 original sequence version: 148 DIP protein P30307 original sequence version: 88 DIP protein P30307 original sequence version: 112 DIP protein P30307 original sequence version: 108 0658A1F1B9B8996A cdk1_human Cyclin-dependent kinase 1 p34 protein kinase Cell division protein kinase 1 CDK1 CDC2 Cell division control protein 2 homolog CDC28A CDKN1 P34CDC2 protein protein human Homo sapiens Human MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM DIP protein P06493 original sequence version: 185 DIP protein P06493 original sequence version: 162 DIP protein P06493 original sequence version: 184 DIP protein P06493 original sequence version: 97 DIP protein P06493 original sequence version: 192 942D79448EFE490A mpip3_mouse M-phase inducer phosphatase 3 Cdc25c Cdc25m1 Dual specificity phosphatase Cdc25C protein protein mouse Mus musculus Mouse MSTGPIPPASEEGSFVSAPSFRSKQRKILHLLLERNTSFTIRSDFPESPKDKLHDSANLSILSGGTPKCCLDLSNLSSGEMSASPLTTSADLEDNGSLDSSGPLDRQLTGKDFHQDLMKGIPVQLLCSTPNAMNHGHRKKIAKRSTSAHKENINTSLKALEWEAPRTPRFRKMPGGPLTSPLCELEMKHLGSPITTVPKLSQNVKLEDQERISEDPMECSLGDQDAKGLSLRKMVPLCDMNAIQMEEEESGSELLIGDFSKVCVLPTVPGKHPDLKYISPDTVAALLSGKFQSVIERFYIIDCRYPYEYLGGHILGALNLHSQKELHEFFLRKPVVPLDIQKRVIIVFLCEFSSERGPRMCRSLREKDRALNQYPALYYPELYILKGGYRDFFPEYMELCDPQSYCPMLHQDHQAELLSWRSQSKAQEGERQLQGQIALLVKGASPQ 513E51BAB3D1A39E lzts1_human Leucine zipper putative tumor suppressor 1 LZTS1 FEZ1 F37/esophageal cancer-related gene-coding leucine-zipper motif Fez1 protein protein human Homo sapiens Human MGSVSSLISGHSFHSKHCRASQYKLRKSSHLKKLNRYSDGLLRFGFSQDSGHGKSSSKMGKSEDFFYIKVSQKARGSHHPDYTALSSGDLGGQAGVDFDPSTPPKLMPFSNQLEMGSEKGAVRPTAFKPVLPRSGAILHSSPESASHQLHPAPPDKPKEQELKPGLCSGALSDSGRNSMSSLPTHSTSSSYQLDPLVTPVGPTSRFGGSAHNITQGIVLQDSNMMSLKALSFSDGGSKLGHSNKADKGPSCVRSPISTDECSIQELEQKLLEREGALQKLQRSFEEKELASSLAYEERPRRCRDELEGPEPKGGNKLKQASQKSQRAQQVLHLQVLQLQQEKRQLRQELESLMKEQDLLETKLRSYEREKTSFGPALEETQWEVCQKSGEISLLKQQLKESQTEVNAKASEILGLKAQLKDTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI 8ED96C707BA27659 cdc2-cdc25c 1 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 6 B the different Cdc25C expression resulted in lower levels of endogenous Cdc25C associated with endogenous Cdk1 in mitotic Lzts1-/- MEFs This interaction occurred in mitotic MEFs. The interaction was stimulated by the presence of Lzts1. cdc25c-cdc2 3 8 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6 C hCdc25C and hLzts1 coprecipitated (Figure 6C), and the increased expression of hLzts1 resulted in increased interaction between hCdc25C and endogenous Cdk1 The amount of CDK1 coimmunoprecipiated with Flag-Cdc25C increases as the amount of V5-Lzts1 increases. Q9Y250; P30307 transfection Q9Y250 over-expressed cdc25c-cdc2-1 3 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey physical association physical association 6 C hCdc25C and hLzts1 coprecipitated P30307 transfection cdc25c-lzts1 2 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association we precipitated the endogenous Cdc25C protein from mitotic or exponentially growing 293 cells known to express high levels of Lzts1 (Ishii et al., 2001). In these conditions, endogenous Lzts1 readily associated with Cdc25C protein, preferentially in mitotic cells 6 I The interaction took place preferentially in mitotic lysates.