MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. EMBO J. (0261-4189) 2007 imex curation Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn 23-MAY-2007: Contacted by JYOTI. A human mammary cDNA library was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn Accepted 2007-JUN-10 by DAVET. 23-MAY-2007: Contacted by JYOTI. A human mammary cDNA library was used. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. EMBO J. (0261-4189) 2007 imex curation Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn 23-MAY-2007: Contacted by JYOTI. A human mammary cDNA library was used. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy predetermined predetermined participant predetermined Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer 293T cells were cotransfected with RFP-PRB and GFP-CUEDC2, not treated with progesterone, and visualized by confocal fluorescence microscopy. xmzhang@nic.bmi.ac.cn Accepted 2007-JUN-10 by DAVET. 23-MAY-2007: Contacted by JYOTI. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. EMBO J. (0261-4189) 2007 imex curation Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn 23-MAY-2007: Contacted by JYOTI. A human mammary cDNA library was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn Accepted 2007-JUN-8 by DAVET. 23-MAY-2007: Contacted by JYOTI. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. EMBO J. (0261-4189) 2007 imex curation Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn 23-MAY-2007: Contacted by JYOTI. A human mammary cDNA library was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast beta galactosidase beta galactosidase complementation beta galactosidase predetermined predetermined participant predetermined Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn Accepted 2007-JUN-11 by DAVET. 23-MAY-2007: Contacted by JYOTI. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. EMBO J. (0261-4189) 2007 imex curation Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn 23-MAY-2007: Contacted by JYOTI. A human mammary cDNA library was used. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn Accepted 2007-JUN-8 by DAVET. 23-MAY-2007: Contacted by JYOTI. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. EMBO J. (0261-4189) 2007 imex curation Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn 23-MAY-2007: Contacted by JYOTI. A human mammary cDNA library was used. Only protein-protein interactions human-t47d human breast cancer tumour cell line-epithelial cells t47d Epithelial cells derived from human breast tumour anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn Accepted 2007-JUN-8 by DAVET. 23-MAY-2007: Contacted by JYOTI. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. EMBO J. (0261-4189) 2007 imex curation Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn 23-MAY-2007: Contacted by JYOTI. A human mammary cDNA library was used. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy predetermined predetermined participant predetermined Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer 293T cells were cotransfected with RFP-PRB and GFP-CUEDC2, treated with progesterone, and visualized by confocal fluorescence microscopy. xmzhang@nic.bmi.ac.cn Accepted 2007-JUN-11 by DAVET. 23-MAY-2007: Contacted by JYOTI. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome. EMBO J. (0261-4189) 2007 imex curation Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn 23-MAY-2007: Contacted by JYOTI. A human mammary cDNA library was used. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang PJ., Zhao J., Li HY., Man JH., He K., Zhou T., Pan X., Li AL., Gong WL., Jin BF., Xia Q., Yu M., Shen BF., Zhang XM. Cancer - Interactions investigated in the context of cancer xmzhang@nic.bmi.ac.cn Accepted 2007-JUN-8 by DAVET. 23-MAY-2007: Contacted by JYOTI. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation cued2_human CUE domain-containing protein 2 CUEDC2 C10orf66 HOYS6 protein protein human Homo sapiens Human MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEAPKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH D092D9A6168E9C15 esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV DIP protein P03372 original sequence version: 214 DIP protein P03372 original sequence version: 139 DIP protein P03372 original sequence version: 167 5455C57AB0CCCAA7 jdp2_human Jun dimerization protein 2 JDP2 protein protein human Homo sapiens Human MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK 29C576AF2C574BA8 ncor2_human Nuclear receptor corepressor 2 NCOR2 CTG26 Silencing mediator of retinoic acid and thyroid hormone receptor Thyroid-, retinoic-acid-receptor-associated corepressor T3 receptor-associating factor CTG repeat protein 26 SMAP270 protein protein human Homo sapiens Human MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVDREITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSGLSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQSAELASMELNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVVEDEEMEASGVSGNEEEMVEEAEALHASGNEVPRGECSGPATVNNSSDTESIPSPHTEAAKDTGQNGPKPPATLGADGPPPGPPTPPPEDIPAPTEPTPASEATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEGEEQKPPAAEELAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGSGRATTAKSSGAPQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGDPRANASPQKPLDLKQLKQRAAAIPPIQVTKVHEPPREDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPRGKSRSPAPPADKEAFAAEAQKLPGDPPCWTSGLPFPVPPREVIKASPHAPDPSAFSYAPPGHPLPLGLHDTARPVLPRPPTISNPPPLISSAKHPSVLERQIGAISQGMSVQLHVPYSEHAKAPVGPVTMGLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTAQEASVLRGTALGSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGEDSPSRLDRGREDSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRAISSASIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKREGTPPPPPPSRDLTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELPLAPRPLKEGSITQGTPLKYDTGASTTGSKKHDVRSLIGSPGRTFPPVHPLDVMADARALERACYEESLKSRPGTASSSGGSIARGAPVIVPELGKPRQSPLTYEDHGAPFAGHLPRGSPVTTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVSGVDLYRSHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHLPVLVPPTPGTPATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSERERDRDRERDRDREREKSILTSTTTVEHAPIWRPGTEQSSGSSGGGGGSSSRPASHSHAHQHSPISPRTQDALQQRPSVLHNTGMKGIITAVEPSTPTVLRSTSTSSPVRPAATFPPATHCPLGGTLDGVYPTLMEPVLLPKEAPRVARPERPRADTGHAFLAKPPARSGLEPASSPSKGSEPRPLVPPVSGHATIARTPAKNLAPHHASPDPPAPPASASDPHREKTQSKPFSIQELELRSLGYHGSSYSPEGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPGPVKLGGEAAHLPHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRSPEPNKTSVLGGGEDGIEPVSPPEGMTEPGHSRSAVYPLLYRDGEQTEPSRMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYNISQPGTEIFNMPAITGTGLMTYRSQAVQEHASTNMGLEAIIRKALMGKYDQWEESPPLSANAFNPLNASASLPAAMPITAADGRSDHTLTSPGGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFPYNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE DIP protein Q9Y618 original sequence version: 166 DIP protein Q9Y618-1 original sequence version: 119 DIP protein Q9Y618-1 original sequence version: 155 DIP protein Q9Y618 original sequence version: 134 DIP protein Q9Y618 original sequence version: 138 70A89C9A19612AAD prgr_human Progesterone receptor PGR NR3C3 Nuclear receptor subfamily 3 group C member 3 protein protein human Homo sapiens Human MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLGPPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPCKAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPPYLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK DIP protein P06401 original sequence version: 196 DIP protein P06401-1 original sequence version: 186 DIP protein P06401-1 original sequence version: 192 80452E54FF3A0454 pgr-cuedc2 1 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association we performed a yeast two-hybrid screen using the IF domain of PR as bait to screen a human mammary cDNA library. We identified two interacting clones containing a complete open reading frame (681 bp) for a 26 000 Da molecular weight gene product that has 100% amino acid identity to human CUEDC2. PREY gene NM_024040 cuedc2-pgr 3 9 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association PREY gene NM_024040 This interaction was confirmed by inverse transformation of yeast cells with GAL4AD-PRB and GAL4DBD-CUEDC2 S1 cuedc2-pgr-1 5 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association BAIT gene NM_024040 1 A, 1 G we used a glutathione S-transferase (GST) pull-down assay. GST-CUEDC2 was expressed in bacteria and purified by glutathione-coupled beads. GSTCUEDC2 was then incubated with Myc-PRB protein expressed in 293T cells and subjected to SDS-PAGE and Western blot. Figure 1A shows that CUEDC2 interacts with PRB with or without progesterone in vitro. This interaction occurs both in the presence and absence of progesterone. cuedc2-pgr-2 8 13 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association BAIT gene NM_024040 1 B This interaction occurs both in the presence and absence of progesterone. 293T cells were transfected with Myc-PRB and HA-CUEDC2 and cultured in the absence or presence of 100 nM progesterone (Figure 1B). HA-CUEDC2 was immunoprecipitated from cell lysates by anti-HA and analyzed for Myc-PRB binding by immunoblotting. As indicated in Figure 1B, Myc-PRB could be co-immunoprecipitated in a ligand-independent manner in the presence of HA-CUEDC2. Q9H467; P06401 transfection esr1-cuedc2 8 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association PREY gene NM_024040 S2 A As shown in Supplementary Figure S2A, we found that CUEDC2 also interacted with ERa. P03372; Q9H467 transfection pgr-cuedc2-1 6 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association PREY gene NM_024040 1 C This interaction occurs both in the presence and absence of progesterone. CUEDC2 was immunoprecipitated with an anti-PR antibody from human T47D breast cancer cells, which express endogenous PR and CUEDC2, and the immunocomplexes were subjected to SDS-PAGE, followed by Western blot analysis. Figure 1C reveals that CUEDC2 is detected in the PR immunocomplexes in the presence or absence of 100 nM progesterone. cuedc2-pgr-3 2 13 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) colocalization colocalization Q9H467 gene NM_024040 In 293T cells cotransfected with PRB and CUEDC2, we found that PRB and CUEDC2 colocalize in the cytoplasm in the absence of progesterone, but colocalized in the nucleus in the presence of progesterone This interaction occurs in the cytoplasm in the absence of progesterone and in the nucleus in the presence of progesterone. 1 E Q9H467; P06401 transfection cuedc2-pgr-4 7 9 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. colocalization colocalization Q9H467 gene NM_024040 In 293T cells cotransfected with PRB and CUEDC2, we found that PRB and CUEDC2 colocalize in the cytoplasm in the absence of progesterone, but colocalized in the nucleus in the presence of progesterone This interaction occurs in the nucleus in the presence of progesterone but in the cytoplasm in its absence. 1 E P06401; Q9H467 transfection cuedc2-pgr-5 5 13 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association BAIT gene NM_024040 1 H PRB binds full-length CUEDC2 and the two CUEDC2 fragments (1-180 and 100-226 aa) containing the CUE domain. In contrast, the CUEDC2 fragments (1-133 and D133-180 aa) lacking the CUE domain failed to interact with PRB. esr1-cuedc2-1 5 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association PREY gene NM_024040 S2 B We performed a GST pull-down assay and found that the DNA domain of ER (180-282 aa) was essential for the interaction between CUEDC2 and ER. Notably, the interaction of CUECD2 with ER was ligand-independent and was similar to the interaction of PR cuedc2-prgr 4 9 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association BAIT gene NM_024040 1 F As indicated in Figure 1F, the IF domain was found to be essential for the interaction of PRB with CUEDC2 in yeast. jdp2-pgr 5 13 unspecified role unspecified role prey prey rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association S7 A Our results demonstrated that CUEDC2 expression did not affect the association of JDP-2 and SMRT with PR This interaction occurred in the presence and absence of CUEDC2. PRB was bound to progesterone. jncor2-pgr 5 13 unspecified role unspecified role prey prey rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association S7 A Our results demonstrated that CUEDC2 expression did not affect the association of JDP-2 and SMRT with PR This interaction occurred in the presence and absence of CUEDC2. PRB was bound to progesterone.