UniProt UniProt http://www.uniprot.org Cooperative interaction between ETS1 and GFI1 transcription factors in the repression of Bax gene expression. Cooperative interaction between ETS1 and GFI1 transcription factors in the repression of Bax gene expression. Oncogene (0950-9232) 2007 imex curation Nakazawa Y., Suzuki M., Manabe N., Yamada T., Kihara-Negishi F., Sakurai T., Tenen D.G., Iwama A., Mochizuki M., Oikawa T. Cancer - Interactions investigated in the context of cancer Interactions relating to HA-and FLAG-tagged ETS1 could not be added as the source of this protein was not given in the publication (fig. 1b and 1c). The species of these constructs has not been confirmed by the authors. oikawat@hoku-iryo-u.dc.jp 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Nakazawa Y., Suzuki M., Manabe N., Yamada T., Kihara-Negishi F., Sakurai T., Tenen D.G., Iwama A., Mochizuki M., Oikawa T. Cancer - Interactions investigated in the context of cancer Interactions relating to HA-and FLAG-tagged ETS1 could not be added as the source of this protein was not given in the publication (fig. 1b and 1c). The species of these constructs has not been confirmed by the authors. oikawat@hoku-iryo-u.dc.jp Accepted 2011-JUL-21 by MGT 26-Sep-2011: Contacted by JYOTI. Oncogene (0950-9232) 2007 mgt Only protein-protein interactions imex curation Cooperative interaction between ETS1 and GFI1 transcription factors in the repression of Bax gene expression. Cooperative interaction between ETS1 and GFI1 transcription factors in the repression of Bax gene expression. Oncogene (0950-9232) 2007 imex curation Nakazawa Y., Suzuki M., Manabe N., Yamada T., Kihara-Negishi F., Sakurai T., Tenen D.G., Iwama A., Mochizuki M., Oikawa T. Cancer - Interactions investigated in the context of cancer Interactions relating to HA-and FLAG-tagged ETS1 could not be added as the source of this protein was not given in the publication (fig. 1b and 1c). The species of these constructs has not been confirmed by the authors. oikawat@hoku-iryo-u.dc.jp 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nakazawa Y., Suzuki M., Manabe N., Yamada T., Kihara-Negishi F., Sakurai T., Tenen D.G., Iwama A., Mochizuki M., Oikawa T. Cancer - Interactions investigated in the context of cancer Interactions relating to HA-and FLAG-tagged ETS1 could not be added as the source of this protein was not given in the publication (fig. 1b and 1c). The species of these constructs has not been confirmed by the authors. oikawat@hoku-iryo-u.dc.jp Accepted 2011-JUL-21 by MGT 26-Sep-2011: Contacted by JYOTI. Oncogene (0950-9232) 2007 mgt Only protein-protein interactions imex curation ets1_human Protein C-ets-1 p54 ETS1 EWSR2 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE DIP protein P14921 original sequence version: 175 3B66BCC464B393FB gfi1_mouse Zinc finger protein Gfi-1 Gfi1 Gfi-1 Growth factor independent protein 1 protein protein mouse Mus musculus Mouse MPRSFLVKSKKAHSYHQPRSPGPDYSLRLETVPAPGRAEGGAVSAGESKMEPRERLSPDSQLTEAPDRASASPNSCEGSVCDPCSEFEDFWRPPSPSVSPASEKSLCRSLDEAQPYTLPFKPYAWSGLAGSDLRHLVQSYRQCSALERSAGLSLFCERGSEPGRPAARYGPEQAAGGAGAGQPGRCGVAGGATSAAGLGLYGDFAPAAAGLYERPSTAAGRLYQDHGHELHADKSVGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK 63AB726025300B6B ets1_mouse Protein C-ets-1 Ets1 Ets-1 p54 protein protein mouse Mus musculus Mouse MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVKPYQVNGANPTYPESCYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILQDPLQTDTLQTDYFAIKQEVLTPDNMCLGRASRGKLGGQDSFESVESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDYEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD DIP protein P27577 original sequence version: 126 151164D83C41B143 gfi1-ets1 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 1a ets1-gfi1-1 1 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait ets domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2b ets1-gfi1-2 1 4 unspecified role unspecified role prey prey zinc finger sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2d