IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ZNF652, a novel zinc finger protein, interacts with the putative breast tumor suppressor CBFA2T3 to repress transcription. ZNF652, a novel zinc finger protein, interacts with the putative breast tumor suppressor CBFA2T3 to repress transcription. Mol. Cancer Res. (1541-7786) 2006 imex curation Kumar R., Manning J., Spendlove HE., Kremmidiotis G., McKirdy R., Lee J., Millband DN., Cheney KM., Stampfer MR., Dwivedi PP., Morris HA., Callen DF. Cancer - Interactions investigated in the context of cancer david.callen@imvs.sa.gov.au 02-MAR-2006: Contacted by JYOTI. The human breast cDNA HYbrid Hunter library (Invitrogen) was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kumar R., Manning J., Spendlove HE., Kremmidiotis G., McKirdy R., Lee J., Millband DN., Cheney KM., Stampfer MR., Dwivedi PP., Morris HA., Callen DF. Cancer - Interactions investigated in the context of cancer david.callen@imvs.sa.gov.au Accepted 2007-FEB-15 by JYOTI. 02-MAR-2006: Contacted by JYOTI. The human breast cDNA HYbrid Hunter library (Invitrogen) was used. Mol. Cancer Res. (1541-7786) 2006 Only protein-protein interactions imex curation ZNF652, a novel zinc finger protein, interacts with the putative breast tumor suppressor CBFA2T3 to repress transcription. ZNF652, a novel zinc finger protein, interacts with the putative breast tumor suppressor CBFA2T3 to repress transcription. Mol. Cancer Res. (1541-7786) 2006 imex curation Kumar R., Manning J., Spendlove HE., Kremmidiotis G., McKirdy R., Lee J., Millband DN., Cheney KM., Stampfer MR., Dwivedi PP., Morris HA., Callen DF. Cancer - Interactions investigated in the context of cancer david.callen@imvs.sa.gov.au 02-MAR-2006: Contacted by JYOTI. The human breast cDNA HYbrid Hunter library (Invitrogen) was used. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kumar R., Manning J., Spendlove HE., Kremmidiotis G., McKirdy R., Lee J., Millband DN., Cheney KM., Stampfer MR., Dwivedi PP., Morris HA., Callen DF. Cancer - Interactions investigated in the context of cancer david.callen@imvs.sa.gov.au Accepted 2007-FEB-15 by JYOTI. 02-MAR-2006: Contacted by JYOTI. The human breast cDNA HYbrid Hunter library (Invitrogen) was used. Mol. Cancer Res. (1541-7786) 2006 Only protein-protein interactions imex curation zn652_human Zinc finger protein 652 ZNF652 KIAA0924 protein protein human Homo sapiens Human MSHTASSCQELVENCAVHVAGMAQEDSRRGQVPSSFYHGANQELDLSTKVYKRESGSPYSVLVDTKMSKPHLHETEEQPYFRETRAVSDVHAVKEDRENSDDTEEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQSKETPVLKTSSEEEEEESEEEATDDSNDYGENEKQKKKEKIVEKVSVTQRRTRRAASVAAATTSPTPRTTRGRRKSVEPPKRKKRATKEPKAPVQKAKCEEKETLTCEKCPRVFNTRWYLEKHMNVTHRRMQICDKCGKKFVLESELSLHQQTDCEKNIQCVSCNKSFKKLWSLHEHIKIVHGYAEKKFSCEICEKKFYTMAHVRKHMVAHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFRCENCDERFQYKYQLRSHMSIHIGHKQFMCQWCGKDFNMKQYFDEHMKTHTGEKPFICEICGKSFTSRPNMKRHRRTHTGEKPYPCDVCGQRFRFSNMLKAHKEKCFRVTSPVNVPPAVQIPLTTSPATPVPSVVNTATTPTPPINMNPVSTLPPRPIPHPFSHLHIHPHPHHPHHLPIPPVPHLPPPPALFKSEPLNHRGQSEDNFLRHLAEKNSSAQHH C066D10E179985CC mtg16_human Protein CBFA2T3 MTG16 MTGR2 ZMYND4 Myeloid translocation gene on chromosome 16 protein MTG8-related protein 2 Zinc finger MYND domain-containing protein 4 CBFA2T3 protein protein human Homo sapiens Human MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPRSTPPSMPPPPPAASQGATRPPSFTPHTHREDGPATLPHGRFHGCLKWSMVCLLMNGSSHSPTAINGAPCTPNGFSNGPATSSTASLSTQHLPPACGARQLSKLKRFLTTLQQFGSDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQTPAQYLAQHEQLLLDASASSPIDSSELLLEVNENGKRRTPDRTKENGSDRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMAHHFRDAYRHPDPRELRERHRPLVVPGSRQEEVIDHKLTEREWAEEWKHLNNLLNCIMDMVEKTRRSLTVLRRCQEADREELNHWARRYSDAEDTKKGPAPAAARPRSSSAGPEGPQLDVPREFLPRTLTGYVPEDIWRKAEEAVNEVKRQAMSELQKAVSDAERKAHELITTERAKMERALAEAKRQASEDALTVINQQEDSSESCWNCGRKASETCSGCNAARYCGSFCQHRDWEKHHHVCGQSLQGPTAVVADPVPGPPEAAHSLGPSLPVGAASPSEAGSAGPSRPGSPSPPGPLDTVPR DIP protein O75081 original sequence version: 124 DIP protein O75081 original sequence version: 65 0B72B602120FA5DE mtg8r_human Protein CBFA2T2 MTG8-related protein 1 MTG8-like protein Myeloid translocation-related protein 1 ETO homologous on chromosome 20 p85 CBFA2T2 EHT MTGR1 protein protein human Homo sapiens Human MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPLPPINPGGPRPVSFTPTALSNGINHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLEHREVRDRHHSLGLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSMAVLRRCQESDREELNYWKRRYNENTELRKTGTELVSRQHSPGSADSLSNDSQREFNSRPGTGYVPVEFWKKTEEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQAAEDAFLVINEQEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQNLHGQSPHGQGRPLLPVGRGSSARSADCSVPSPALDKTSATTSRSSTPASVTAIDTNGL DIP protein O43439 original sequence version: 142 1E55618844908169 mtg8_human Protein CBFA2T1 Protein MTG8 Protein ETO Eight twenty one protein Cyclin-D-related protein Zinc finger MYND domain-containing protein 2 RUNX1T1 AML1T1 CBFA2T1 CDR ETO MTG8 ZMYND2 protein protein human Homo sapiens Human MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR DIP protein Q06455 original sequence version: 75 DIP protein Q06455 original sequence version: 146 C3D2452F96E65679 atn1_human Atrophin-1 ATN1 DRPLA Dentatorubral-pallidoluysian atrophy protein D12S755E protein protein human Homo sapiens Human MKTRQNKDSMSMRSGRKKEAPGPREELRSRGRASPGGVSTSSSDGKAEKSRQTAKKARVEEASTPKVNKQGRSEEISESESEETNAPKKTKTEQELPRPQSPSDLDSLDGRSLNDDGSSDPRDIDQDNRSTSPSIYSPGSVENDSDSSSGLSQGPARPYHPPPLFPPSPQPPDSTPRQPEASFEPHPSVTPTGYHAPMEPPTSRMFQAPPGAPPPHPQLYPGGTGGVLSGPPMGPKGGGAASSVGGPNGGKQHPPPTTPISVSSSGASGAPPTKPPTTPVGGGNLPSAPPPANFPHVTPNLPPPPALRPLNNASASPPGLGAQPLPGHLPSPHAMGQGMGGLPPGPEKGPTLAPSPHSLPPASSSAPAPPMRFPYSSSSSSSAAASSSSSSSSSSASPFPASQALPSYPHSFPPPTSLSVSNQPPKYTQPSLPSQAVWSQGPPPPPPYGRLLANSNAHPGPFPPSTGAQSTAHPPVSTHHHHHQQQQQQQQQQQQQQQQQQQHHGNSGPPPPGAFPHPLEGGSSHHAHPYAMSPSLGSLRPYPPGPAHLPPPHSQVSYSQAGPNGPPVSSSSNSSSSTSQGSYPCSHPSPSQGPQGAPYPFPPVPTVTTSSATLSTVIATVASSPAGYKTASPPGPPPYGKRAPSPGAYKTATPPGYKPGSPPSFRTGTPPGYRGTSPPAGPGTFKPGSPTVGPGPLPPAGPSGLPSLPPPPAAPASGPPLSATQIKQEPAEEYETPESPVPPARSPSPPPKVVDVPSHASQSARFNKHLDRGFNSCARSDLYFVPLEGSKLAKKRADLVEKVRREAEQRAREEKEREREREREKEREREKERELERSVKLAQEGRAPVECPSLGPVPHRPPFEPGSAVATVPPYLGPDTPALRTLSEYARPHVMSPGNRNHPFYVPLGAVDPGLLGYNVPALYSSDPAAREREREARERDLRDRLKPGFEVKPSELEPLHGVPGPGLDPFPRHGGLALQPGPPGLHPFPFHPSLGPLERERLALAAGPALRPDMSYAERLAAERQHAERVAALGNDPLARLQMLNVTPHHHQHSHIHSHLHLHQQDAIHAASASVHPLIDPLASGSHLTRIPYPAGTLPNPLLPHPLHENEVLRHQLFAAPYRDLPASLSAPMSAAHQLQAMHAQSAELQRLALEQQQWLHAHHPLHSVPLPAQEDYYSHLKKESDKPL B47603486C672637 B47603486C672637 cbfa2t3-znf652 1 3 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1190253]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 617-617, sequence length 606 [EBI-1190253]557-617 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association In addition to atrophin-1, a cDNA encoding the 61COOH-terminal amino acids of a previously uncharacterized protein ZNF652 was identified. The Uniprotkb accession number O75081 also corresponds to CBFA2T3 but has an F at position 231 instead of L as in Q0P5Z6. The predicted translation of NM_014897 (the sequence used to identify ZNF652 by the authors) is missing 11 aa at the N-terminus when aligned against Q9Y2D9. cbfa2t3-atn1 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association In addition to atrophin-1, a cDNA encoding the 61COOH-terminal amino acids of a previously uncharacterized protein ZNF652 was identified. The Uniprotkb accession number O75081 also corresponds to CBFA2T3 but has an F at position 231 instead of L as in Q0P5Z6. cbfa2t3-znf652-1 2 3 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1190278]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 617-617, sequence length 606 [EBI-1190278]509-617 region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The Uniprotkb accession number O75081 also corresponds to CBFA2T3 but has an F at position 231 instead of L as in Q0P5Z6. The predicted translation of NM_014897 (the sequence used to identify ZNF652 by the authors) is missing 11 aa at the N-terminus when aligned against Q9Y2D9. 3 HA-ZNF652 was clearly detected in complexes immunoprecipitated with anti-myc antibody that binds to myc- CBFA2T3 The results indicate the C-terminal 109 aa of ZNF652 interact with CBFA2T3. The interaction may be stabilized by the zinc finger region as the interaction was stronger with ZNF652(254-617). cbfa2t1-znf652-2 2 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The predicted translation of NM_014897 (the sequence used to identify ZNF652 by the authors) is missing 11 aa at the N-terminus when aligned against Q9Y2D9. 3 A This interaction was specific to CBFA2T3 as coimmunoprecipitation of the related proteins CBFA2T2 and CBFA2T1 showed only a weak interaction with ZNF652 cbfa2t2-znf652-3 2 5 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The predicted translation of NM_014897 (the sequence used to identify ZNF652 by the authors) is missing 11 aa at the N-terminus when aligned against Q9Y2D9. 3 A This interaction was specific to CBFA2T3 as coimmunoprecipitation of the related proteins CBFA2T2 and CBFA2T1 showed only a weak interaction with ZNF652