IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Epm2a suppresses tumor growth in an immunocompromised host by inhibiting Wnt signaling. Epm2a suppresses tumor growth in an immunocompromised host by inhibiting Wnt signaling. Cancer Cell (1535-6108) 2006 imex curation Wang Y., Liu Y., Wu C., Zhang H., Zheng X., Zheng Z., Geiger TL., Nuovo GJ., Liu Y., Zheng P. Cancer - Interactions investigated in the context of cancer Information regarding accession numbers of proteins was obtained via email from the authors which can be found at P:\pro4\intact\local\data\curation-material\wang-2006d. panz@umich.edu,yangl@umich.edu 30-OCT-2006: Contacted by JYOTI. Only protein-protein interactions 2 in vitro In vitro phosphatase assay phosphatase assay antibody detection identification by antibody antibody detection Wang Y., Liu Y., Wu C., Zhang H., Zheng X., Zheng Z., Geiger TL., Nuovo GJ., Liu Y., Zheng P. Cancer - Interactions investigated in the context of cancer Information regarding accession numbers of proteins was obtained via email from the authors which can be found at P:\pro4\intact\local\data\curation-material\wang-2006d. panz@umich.edu,yangl@umich.edu Accepted 2006-OCT-3 by ORCHARD. 30-OCT-2006: Contacted by JYOTI. Cancer Cell (1535-6108) 2006 Only protein-protein interactions 2 imex curation Epm2a suppresses tumor growth in an immunocompromised host by inhibiting Wnt signaling. Epm2a suppresses tumor growth in an immunocompromised host by inhibiting Wnt signaling. Cancer Cell (1535-6108) 2006 imex curation Wang Y., Liu Y., Wu C., Zhang H., Zheng X., Zheng Z., Geiger TL., Nuovo GJ., Liu Y., Zheng P. Cancer - Interactions investigated in the context of cancer Information regarding accession numbers of proteins was obtained via email from the authors which can be found at P:\pro4\intact\local\data\curation-material\wang-2006d. panz@umich.edu,yangl@umich.edu 30-OCT-2006: Contacted by JYOTI. Only protein-protein interactions 2 mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang Y., Liu Y., Wu C., Zhang H., Zheng X., Zheng Z., Geiger TL., Nuovo GJ., Liu Y., Zheng P. Cancer - Interactions investigated in the context of cancer Information regarding accession numbers of proteins was obtained via email from the authors which can be found at P:\pro4\intact\local\data\curation-material\wang-2006d. panz@umich.edu,yangl@umich.edu Accepted 2006-OCT-3 by ORCHARD. 30-OCT-2006: Contacted by JYOTI. Cancer Cell (1535-6108) 2006 Only protein-protein interactions 2 imex curation Epm2a suppresses tumor growth in an immunocompromised host by inhibiting Wnt signaling. Epm2a suppresses tumor growth in an immunocompromised host by inhibiting Wnt signaling. Cancer Cell (1535-6108) 2006 imex curation Wang Y., Liu Y., Wu C., Zhang H., Zheng X., Zheng Z., Geiger TL., Nuovo GJ., Liu Y., Zheng P. Cancer - Interactions investigated in the context of cancer Information regarding accession numbers of proteins was obtained via email from the authors which can be found at P:\pro4\intact\local\data\curation-material\wang-2006d. panz@umich.edu,yangl@umich.edu 30-OCT-2006: Contacted by JYOTI. Only protein-protein interactions 2 mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang Y., Liu Y., Wu C., Zhang H., Zheng X., Zheng Z., Geiger TL., Nuovo GJ., Liu Y., Zheng P. Cancer - Interactions investigated in the context of cancer Information regarding accession numbers of proteins was obtained via email from the authors which can be found at P:\pro4\intact\local\data\curation-material\wang-2006d. panz@umich.edu,yangl@umich.edu Accepted 2006-OCT-3 by ORCHARD. 13-NOV-2006: Contacted by JYOTI. 30-OCT-2006: Contacted by JYOTI. Cancer Cell (1535-6108) 2006 Only protein-protein interactions 2 imex curation gsk3b-hu-bsa_protein Fusion of a modified peptide representing human GSK-3beta to bovine serum albumin (BSA) peptide peptide polypeptide oligopeptide oligopeptide polypeptide human Homo sapiens Human CGPKGPGRRGRRRTSSFAEG An amino acid sequence which is not represented in UniProt Residue 15 (serine) is phosphorylated. The protein reference given by the authors for the human GSK-3beta (NP_002084) has an insertion of 13 residues between residues 303 and 304 of the Uniprotkb sequence (P49841). C3F7D8ADE9F87FF3 gsk3b_mouse Glycogen synthase kinase-3 beta Gsk3b Serine/threonine-protein kinase GSK3B protein protein mouse Mus musculus Mouse MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST DIP protein Q9WV60 original sequence version: 159 200C3FD1B38B4883 epm2a_mouse Laforin Epm2a Lafora PTPase Glucan phosphatase protein protein mouse Mus musculus Mouse MLFRFGVVVPPAVAGARQELLLAGSRPELGRWEPHGAVRLRPAGTAAGAAALALQEPGLWLAEVELEAYEEAGGAEPGRVDTFWYKFLQREPGGELHWEGNGPHHDRCCTYNEDNLVDGVYCLPVGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQLEHVTIKLKHELGVTAVMNFQTEWDIIQNSSGCNRYPEPMTPDTMMKLYKEEGLSYIWMPTPDMSTEGRVQMLPQAVCLLHALLENGHTVYVHCNAGVGRSTAAVCGWLHYVIGWNLRKVQYFIMAKRPAVYIDEDALAQAQQDFSQKFGKVHSSICAL 89B18C64BBBAB02A gsk3b-epm2a 3 6 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait physical association physical association 7 E, S3 anti-GSK-3b, but not control IgG1, brought down both GSK-3b and V5-tagged laforin proteins in the Epm2a-transfected cells, but not in the vector transfected cells. Laforin-GSK-3β association was unaffected by PDGF stimulation and did not require phosphastase activity of laforin The mutation in laforin (cys265ser) did not affect binding, indicating the association does not require laforin phosphatase activity. The association was not affected by PDGF. gsk3b-epm2a-1 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 7 E we precipitated the GSK-3b in untransfected NIH3T3 cells and probed the precipitates with antibody specific for laforin. As shown in the lower panel of Figure 7E, significant amounts of laforin were coprecipitated with GSK-3b. epm2a-gsk3b 1 4 enzyme target enzyme target substrate substrate unspecified role unspecified role ser-15 the peptide representing human GSK3-beta is phopshorylated on Ser15 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 enzyme enzyme unspecified role unspecified role region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9WUA5:p.Cys265Ser mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:28:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys265ser' Tue Jun 30 15:35:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys265Ser' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. dephosphorylation dephosphorylation reaction dephosphorylation 7 F the wild-type but not the C265S mutant laforin dephosphorylated the p-Ser9 peptide. The same laforin preparation, however, failed to dephosphorylate Bad The peptide representing human GSK-3beta (with modifications) fused to BSA, is dephosphorylated on ser15. The authors state that this residue corresponds to GSK-3beta Ser9. This dephosphorylation was detected using antibodies specific for phosphorylated GSK-3beta Ser9. The laforin did not dephosphorylate Bad.