IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Delocalization and destabilization of the Arf tumor suppressor by the leukemia-associated NPM mutant. Delocalization and destabilization of the Arf tumor suppressor by the leukemia-associated NPM mutant. Cancer research 2006 imex curation Colombo E., Martinelli P., Zamponi R., Shing DC., Bonetti P., Luzi L., Volorio S., Bernard L., Pruneri G., Alcalay M., Pelicci PG. Cancer - Interactions investigated in the context of cancer Rare diseases - Interactions investigated in the context of Rare genetic disease piergiuseppe.pelicci@ifom-ieo-campus.it 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Colombo E., Martinelli P., Zamponi R., Shing DC., Bonetti P., Luzi L., Volorio S., Bernard L., Pruneri G., Alcalay M., Pelicci PG. Cancer - Interactions investigated in the context of cancer NPM and p53 genes were knocked-out in MEF cells piergiuseppe.pelicci@ifom-ieo-campus.it Accepted 2020-AUG-17 AT 08:22 BST AT 08:22 BST by ORCHARD Cancer research 2006 Only protein-protein interactions imex curation imex curation npm2_human Nucleoplasmin-2 NPM2 protein protein human Homo sapiens Human MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK EAE3BEF1DC8E1CC1 npm_human Nucleophosmin NPM1 NPM Nucleolar phosphoprotein B23 Numatrin Nucleolar protein NO38 protein protein human Homo sapiens Human MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL 620BC7BA2E4A0054 arf_mouse Tumor suppressor ARF Cdkn2a p19ARF Alternative reading frame Cyclin-dependent kinase inhibitor 2A protein protein mouse Mus musculus Mouse MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSAGRLPGHAGGAARVRGSAGCARCLGSPAARLGPRAGTSRHRAIFAFRWVLFVFRWVVFVYRWERRPDRRA DIP protein Q64364 original sequence version: 97 DIP protein Q64364 original sequence version: 110 644505EFE1CBF478 cdkn2a-npm1-1 1 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4b npm2-cdkn2a-1 1 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 4b cdkn2a-npm1-2 1 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P06748:p.Trp288_Leu294delinsCysLeuAlaValGluGluValSerLeuArgLys P06748:p.Trp288Cysfs*12 mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain WQWRKSL CLAVEEVSLRK Wed Sep 16 10:35:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P06748:p.Trp288Cysfs*12' physical association physical association Fig. 4b