IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cyclin D1-dependent kinase activity in murine development and mammary tumorigenesis. Cyclin D1-dependent kinase activity in murine development and mammary tumorigenesis. Cancer Cell (1535-6108) 2006 imex curation Landis MW., Pawlyk BS., Li T., Sicinski P., Hinds PW. Cancer - Interactions investigated in the context of cancer phinds@tufts-nemc.org 25-OCT-2006: Contacted by JYOTI. Only protein-protein interactions 1 mouse-retina Mus musculus retina retina retinal tissue anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Landis MW., Pawlyk BS., Li T., Sicinski P., Hinds PW. Cancer - Interactions investigated in the context of cancer phinds@tufts-nemc.org Accepted 2006-SEP-26 by JYOTI. 25-OCT-2006: Contacted by JYOTI. Cancer Cell (1535-6108) 2006 Only protein-protein interactions 1 imex curation cdn1b_mouse Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 Cdkn1b protein protein mouse Mus musculus Mouse MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVLAQESQDVSGSRQAVPLIGSQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPNAGTVEQTPKKPGLRRQT DIP protein P46414 original sequence version: 87 BAC30D648B9BA3D6 cdk4_mouse Cyclin-dependent kinase 4 Cell division protein kinase 4 PSK-J3 CRK3 Cdk4 Crk3 protein protein mouse Mus musculus Mouse MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEESDAE DIP protein P30285 original sequence version: 145 DIP protein P30285 original sequence version: 129 DIP protein P30285 original sequence version: 82 DIP protein P30285 original sequence version: 102 CB4F42A8AA13634A ccnd1_mouse G1/S-specific cyclin-D1 Ccnd1 Cyl-1 protein protein mouse Mus musculus Mouse MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEVEEEAGLACTPTDVRDVDI DIP protein P25322 original sequence version: 139 DIP protein P25322 original sequence version: 123 DIP protein P25322 original sequence version: 75 3A79736B4163251B cdk4-ccnd1-7 1 4 unspecified role unspecified role prey prey 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait association association 2 D we observed that cyclin D1 KE-CDK4 complexes retained the ability to bind p27Kip1 (Figure 2D). Although less CDK4 was immunoprecipitated from the cyclin D1KE/KE lysates, as might be expected due to the decreased CDK4 expression in the knockin retinas, the relative amounts of cyclin D1 KE protein and p27Kip1 that coimmunoprecipitated with CDK4 were similar in the wild-type and cyclin D1KE/KE lysates. As expected, virtually no p27Kip1 coimmunoprecipitated with CDK4 from cyclin D12/2 retinas, confirming the requirement for cyclin D1 in p27Kip1 titration Cylin D1 is required for the formation of this complex. The lys112glu mutation in cyclin D1 does not significantly affect formation of this complex although less of this protein is expressed.