IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Apoptosis induced by a new member of saponin family is mediated through caspase-8-dependent cleavage of Bcl-2. Apoptosis induced by a new member of saponin family is mediated through caspase-8-dependent cleavage of Bcl-2. Mol. Pharmacol. (0026-895X) 2005 imex curation Zhu J., Xiong L., Yu B., Wu J. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The range for the p10 subunit of caspase-8 was taken from the UniProtKB entry for this protein. The cysteine in the active site of the large (p18) subunit was also identified from the UniProtKB entry. wujr@sibs.ac.cn 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhu J., Xiong L., Yu B., Wu J. Apoptosis - Interactions involving proteins with a function related to apoptosis wujr@sibs.ac.cn Accepted 2008-SEP-6 by DAVET. 27-Aug-2008: Contacted by JYOTI. Mol. Pharmacol. (0026-895X) 2005 davet Only protein-protein interactions imex curation Apoptosis induced by a new member of saponin family is mediated through caspase-8-dependent cleavage of Bcl-2. Apoptosis induced by a new member of saponin family is mediated through caspase-8-dependent cleavage of Bcl-2. Mol. Pharmacol. (0026-895X) 2005 imex curation Zhu J., Xiong L., Yu B., Wu J. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The range for the p10 subunit of caspase-8 was taken from the UniProtKB entry for this protein. The cysteine in the active site of the large (p18) subunit was also identified from the UniProtKB entry. wujr@sibs.ac.cn 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu J., Xiong L., Yu B., Wu J. Apoptosis - Interactions involving proteins with a function related to apoptosis The range for the p10 subunit of caspase-8 was taken from the UniProtKB entry for this protein. The cysteine in the active site of the large (p18) subunit was also identified from the UniProtKB entry. wujr@sibs.ac.cn Accepted 2008-JUN-21 by DAVET. Mol. Pharmacol. (0026-895X) 2005 davet Only protein-protein interactions imex curation casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD DIP protein Q14790 original sequence version: 184 DIP protein Q14790 original sequence version: 135 DIP protein Q14790 original sequence version: 136 DIP protein Q14790 original sequence version: 147 DIP protein Q14790 original sequence version: 146 DIP protein Q14790 original sequence version: 170 DIP protein Q14790 original sequence version: 198 DIP protein Q14790-1 original sequence version: 197 DIP protein Q14790 original sequence version: 158 7A5FEAA6B39B582F bcl2_crigr Apoptosis regulator Bcl-2 BCL2 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRDMAARTSPLRPIVATTGPTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGTYLGHK BECADF1EF3337228 bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB casp8-bcl2 2 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait c-terminal p10 small subunit sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range Q14790:p.Cys360Ser mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:45:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys360ser' Tue Jun 30 16:36:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys360Ser' physical association physical association 6 A indicating that caspase-8 is capable of interacting with Bcl-2 via its small subunit. The range for the p10 subunit of caspase-8 was taken from the UniProtKB entry for this protein, as this information was not given by the authors. bcl2-casp8 1 3 unspecified role unspecified role prey prey c-terminal p10 small subunit sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait physical association physical association 6 B to verify the existence of the physical association between caspase-8 small subunit and Bcl-2. In CHO cells, the endogenous Bcl-2 was found to coimmunoprecipitate with the ectopically expressed EGFP-fused p10 subunit