IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ S100P promotes pancreatic cancer growth, survival, and invasion. S100P promotes pancreatic cancer growth, survival, and invasion. Clin. Cancer Res. (1078-0432) 2005 imex curation Arumugam T., Simeone DM., Van Golen K., Logsdon CD. Cancer - Interactions investigated in the context of cancer clogsdon@mdanderson.org 16-April-2008: Contacted by JYOTI. davet Only protein-protein interactions human-bxpc3 Homo sapiens primary pancreatic adenocarcinoma cell line bxpc3 BxPC-3 Human primary pancreatic adenocarcinoma cell line Derived from a 61 year old female with a primary adenocarcinoma of the pancreas. BxPC-3 cells produce mucin and the tumour in a nude mouse is moderately well to poorly differentiated like the primary adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arumugam T., Simeone DM., Van Golen K., Logsdon CD. Cancer - Interactions investigated in the context of cancer clogsdon@mdanderson.org Accepted 2008-APR-19 by DAVET. Clin. Cancer Res. (1078-0432) 2005 davet Only protein-protein interactions imex curation rage_human Advanced glycosylation end product-specific receptor AGER RAGE Receptor for advanced glycosylation end products protein protein human Homo sapiens Human MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP DIP protein Q15109 original sequence version: 157 0D584C436C30CCE7 s100p_human Protein S100-P S100 calcium-binding protein P S100P S100E Protein S100-E Migration-inducing gene 9 protein protein protein human Homo sapiens Human MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK 786E6E3F3EACC6C1 ager-s100p 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association 6 B BxPc3 cell lysates were immunoprecipitated with anti-RAGE antibody and S100P was identified in the precipitate by Western blotting. Amphoterin peptide - inclusion of the amphoterin peptide almost completely blocked the coimmunoprecipitation of S100P with RAGE. s100p-ager 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 6 B Amphoterin peptide - inclusion of the amphoterin peptide almost completely blocked the coimmunoprecipitation of RAGE with S100P.