IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human homologue of maid is a useful marker protein in hepatocarcinogenesis. Human homologue of maid is a useful marker protein in hepatocarcinogenesis. Gastroenterology (0016-5085) 2005 imex curation Takami T., Terai S., Yokoyama Y., Tanimoto H., Tajima K., Uchida K., Yamasaki T., Sakaida I., Nishina H., Thorgeirsson SS., Okita K. Cancer - Interactions investigated in the context of cancer terais@yamaguchi-u.ac.jp 07-Sept-2007: Contacted by JYOTI. A human bone marrow cDNA library (Clontech) was used. orchard Only protein-protein interactions human-kmc_1 Homo sapiens cholangiocellular (bile duct) carcinoma cell line kmc_1 cholangiocellular (bile duct) carcinoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Takami T., Terai S., Yokoyama Y., Tanimoto H., Tajima K., Uchida K., Yamasaki T., Sakaida I., Nishina H., Thorgeirsson SS., Okita K. Cancer - Interactions investigated in the context of cancer terais@yamaguchi-u.ac.jp Accepted 2007-SEP-31 by ORCHARD. 07-Sept-2007: Contacted by JYOTI. Gastroenterology (0016-5085) 2005 orchard Only protein-protein interactions imex curation Human homologue of maid is a useful marker protein in hepatocarcinogenesis. Human homologue of maid is a useful marker protein in hepatocarcinogenesis. Gastroenterology (0016-5085) 2005 imex curation Takami T., Terai S., Yokoyama Y., Tanimoto H., Tajima K., Uchida K., Yamasaki T., Sakaida I., Nishina H., Thorgeirsson SS., Okita K. Cancer - Interactions investigated in the context of cancer terais@yamaguchi-u.ac.jp 07-Sept-2007: Contacted by JYOTI. A human bone marrow cDNA library (Clontech) was used. orchard Only protein-protein interactions human-kmc_1 Homo sapiens cholangiocellular (bile duct) carcinoma cell line kmc_1 cholangiocellular (bile duct) carcinoma cell line confocal microscopy confocal microscopy immunostaining immunostaining Takami T., Terai S., Yokoyama Y., Tanimoto H., Tajima K., Uchida K., Yamasaki T., Sakaida I., Nishina H., Thorgeirsson SS., Okita K. Cancer - Interactions investigated in the context of cancer terais@yamaguchi-u.ac.jp Accepted 2007-SEP-31 by ORCHARD. 07-Sept-2007: Contacted by JYOTI. Gastroenterology (0016-5085) 2005 orchard Only protein-protein interactions imex curation Human homologue of maid is a useful marker protein in hepatocarcinogenesis. Human homologue of maid is a useful marker protein in hepatocarcinogenesis. Gastroenterology (0016-5085) 2005 imex curation Takami T., Terai S., Yokoyama Y., Tanimoto H., Tajima K., Uchida K., Yamasaki T., Sakaida I., Nishina H., Thorgeirsson SS., Okita K. Cancer - Interactions investigated in the context of cancer terais@yamaguchi-u.ac.jp 07-Sept-2007: Contacted by JYOTI. A human bone marrow cDNA library (Clontech) was used. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Takami T., Terai S., Yokoyama Y., Tanimoto H., Tajima K., Uchida K., Yamasaki T., Sakaida I., Nishina H., Thorgeirsson SS., Okita K. Cancer - Interactions investigated in the context of cancer terais@yamaguchi-u.ac.jp Accepted 2007-SEP-31 by ORCHARD. 07-Sept-2007: Contacted by JYOTI. A human bone marrow cDNA library (Clontech) was used. Gastroenterology (0016-5085) 2005 orchard Only protein-protein interactions imex curation Human homologue of maid is a useful marker protein in hepatocarcinogenesis. Human homologue of maid is a useful marker protein in hepatocarcinogenesis. Gastroenterology (0016-5085) 2005 imex curation Takami T., Terai S., Yokoyama Y., Tanimoto H., Tajima K., Uchida K., Yamasaki T., Sakaida I., Nishina H., Thorgeirsson SS., Okita K. Cancer - Interactions investigated in the context of cancer terais@yamaguchi-u.ac.jp 07-Sept-2007: Contacted by JYOTI. A human bone marrow cDNA library (Clontech) was used. orchard Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). confocal microscopy confocal microscopy immunostaining immunostaining Takami T., Terai S., Yokoyama Y., Tanimoto H., Tajima K., Uchida K., Yamasaki T., Sakaida I., Nishina H., Thorgeirsson SS., Okita K. Cancer - Interactions investigated in the context of cancer terais@yamaguchi-u.ac.jp Accepted 2007-SEP-31 by ORCHARD. 07-Sept-2007: Contacted by JYOTI. Gastroenterology (0016-5085) 2005 orchard Only protein-protein interactions imex curation ccdb1_human Cyclin-D1-binding protein 1 Grap2 and cyclin-D-interacting protein Human homolog of Maid CCNDBP1 DIP1 GCIP HHM protein protein human Homo sapiens Human MASATAPAAAVPTLASPLEQLRHLAEELRLLLPRVRVGEAQETTEEFNREMFWRRLNEAAVTVSREATTLTIVFSQLPLPSPQETQKFCEQVHAAIKAFIAVYYLLPKDQGITLRKLVRGATLDIVDGMAQLMEVLSVTPTQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQDLYWSEDDQELIIPCLALVRASKACLKKIRMLVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL 40C7C3686632F6A7 csn5_human COP9 signalosome complex subunit 5 Jun activation domain-binding protein 1 COPS5 CSN5 JAB1 protein protein human Homo sapiens Human MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS DIP protein Q92905 original sequence version: 161 DIP protein Q92905 original sequence version: 87 DIP protein Q92905 original sequence version: 132 DIP protein Q92905 original sequence version: 149 DIP protein Q92905 original sequence version: 136 DIP protein Q92905 original sequence version: 101 B5742F4AAD03A1CF ccndbp1-cops5 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association A yeast 2-hybrid screen identified Jun activation domain-binding protein 1 (Jab1) as a binding partner for HHM. ccndbp1-cops5-1 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association nuclear proteins were extracted from KMC-1 cells and then used in immunoprecipitation. The results con-firmed binding of HHM to Jab1 5A ccndbp1-cops5-2 2 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization the intracellular localization of HHM (Figure 6A and 6E) and Jab1 proteins (Figure 6B and 6F) were analyzed in each cell line (KMC-1 and HepG2 cells) by immunofluorescent staining, and the results showed that these 2 proteins were bound in the nucleus 6 D ccndbp1-cops5-3 4 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization the intracellular localization of HHM (Figure 6A and 6E) and Jab1 proteins (Figure 6B and 6F) were analyzed in each cell line (KMC-1 and HepG2 cells) by immunofluorescent staining, and the results showed that these 2 proteins were bound in the nucleus 6 H ccndbp1-cops5-5 1 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association nuclear proteins were extracted from KMC-1 cells and then used in immunoprecipitation. The results con-firmed binding of HHM to Jab1 5B