IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion. p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion. Cancer Cell (1535-6108) 2005 Baldassarre G., Belletti B., Nicoloso MS., Schiappacassi M., Vecchione A., Spessotto P., Morrione A., Canzonieri V., Colombatti A. Cancer - Interactions investigated in the context of cancer gbaldassarre@cro.it 25-OCT-2006: Contacted by JYOTI. mouse-fibroblast Mus musculus fibroblast Fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baldassarre G., Belletti B., Nicoloso MS., Schiappacassi M., Vecchione A., Spessotto P., Morrione A., Canzonieri V., Colombatti A. Cancer - Interactions investigated in the context of cancer The mouse fibroblasts were adherent to FN. gbaldassarre@cro.it Accepted 2006-SEP-21 by ORCHARD. 25-OCT-2006: Contacted by JYOTI. Cancer Cell (1535-6108) 2005 p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion. p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion. Cancer Cell (1535-6108) 2005 Baldassarre G., Belletti B., Nicoloso MS., Schiappacassi M., Vecchione A., Spessotto P., Morrione A., Canzonieri V., Colombatti A. Cancer - Interactions investigated in the context of cancer gbaldassarre@cro.it 25-OCT-2006: Contacted by JYOTI. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baldassarre G., Belletti B., Nicoloso MS., Schiappacassi M., Vecchione A., Spessotto P., Morrione A., Canzonieri V., Colombatti A. Cancer - Interactions investigated in the context of cancer Mouse fetal brain (day 18 p.c.) was used gbaldassarre@cro.it Accepted 2006-SEP-21 by ORCHARD. 25-OCT-2006: Contacted by JYOTI. Cancer Cell (1535-6108) 2005 p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion. p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion. Cancer Cell (1535-6108) 2005 Baldassarre G., Belletti B., Nicoloso MS., Schiappacassi M., Vecchione A., Spessotto P., Morrione A., Canzonieri V., Colombatti A. Cancer - Interactions investigated in the context of cancer gbaldassarre@cro.it 25-OCT-2006: Contacted by JYOTI. pig-brain Sus scrofa pig brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baldassarre G., Belletti B., Nicoloso MS., Schiappacassi M., Vecchione A., Spessotto P., Morrione A., Canzonieri V., Colombatti A. Cancer - Interactions investigated in the context of cancer Adult pig brain was used. gbaldassarre@cro.it Accepted 2006-SEP-21 by ORCHARD. 25-OCT-2006: Contacted by JYOTI. Cancer Cell (1535-6108) 2005 p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion. p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion. Cancer Cell (1535-6108) 2005 Baldassarre G., Belletti B., Nicoloso MS., Schiappacassi M., Vecchione A., Spessotto P., Morrione A., Canzonieri V., Colombatti A. Cancer - Interactions investigated in the context of cancer gbaldassarre@cro.it 25-OCT-2006: Contacted by JYOTI. human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Baldassarre G., Belletti B., Nicoloso MS., Schiappacassi M., Vecchione A., Spessotto P., Morrione A., Canzonieri V., Colombatti A. Cancer - Interactions investigated in the context of cancer gbaldassarre@cro.it Accepted 2006-SEP-21 by ORCHARD. 25-OCT-2006: Contacted by JYOTI. Cancer Cell (1535-6108) 2005 q9bdc3_pig Cyclin-dependent kinase inhibitor 1B CDKN1B p27Kip1 Cyclin-dependent kinase inhibitor p27 protein protein pig Sus scrofa (Pig) Pig MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQEGQGVSGTRQAVPLIGSQANSEDTHLVDQKTDAPDSQTGLAEQCTGIRKRPATDDSSPQNKRANRTEENVSDGSPNSASVEQTPKKPGLRRRQT E5B01D225E5BDD5F cdn1b_human Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 CDKN1B KIP1 protein protein human Homo sapiens Human MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT DIP protein P46527 original sequence version: 120 DIP protein P46527 original sequence version: 115 DIP protein P46527 original sequence version: 154 DIP protein P46527 original sequence version: 168 DIP protein P46527 original sequence version: 164 DIP protein P46527 original sequence version: 118 1118D58901CDF3FC stmn1_mouse Stathmin Phosphoprotein p19 Leukemia-associated phosphoprotein p18 Oncoprotein 18 pp17 Prosolin Metablastin Protein Pr22 Leukemia-associated gene protein Stmn1 Lag Lap18 Pr22 protein protein mouse Mus musculus Mouse MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHVEEVRKNKESKDPADETEAD 616526E0A6667BDA stmn1_human Stathmin Phosphoprotein p19 Leukemia-associated phosphoprotein p18 Oncoprotein 18 pp17 Prosolin Metablastin Protein Pr22 STMN1 LAP18 OP18 C1orf215 protein protein human Homo sapiens Human MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD 316426F60DABCD01 stmn1_pig Stathmin STMN1 protein protein pig Sus scrofa (Pig) Pig MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD 316426F60DABCD01 cdn1b_mouse Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 Cdkn1b protein protein mouse Mus musculus Mouse MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVLAQESQDVSGSRQAVPLIGSQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPNAGTVEQTPKKPGLRRQT DIP protein P46414 original sequence version: 87 BAC30D648B9BA3D6 stmn1-cdkn1b 4 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region EGFP tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The protein (AAA20240) coded for by the p27 sequence they refer to (U10906) has a Ser at position 175 whereas the Uniprot sequence has a Leu. Coim-munoprecipitation (co-IP) analysis showed that p27wt interacted in vivo with stathmin and that this interaction derived cell clones, and of p27 wt and null cells. Expression of was severely imp27 had no effect on the adhesion of HT-1080 cells (Figure 2E) paired by the deletion of the last 27 amino acids of p27 3 A cdkn1b-stmn1 2 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 3 B stathmin was readily co-IP with p27 from mouse fetal brain (day 18 p.c.) Stathmin is a ubiquitous protein expressed at highest levels in brain, which peaks in the neonatal period and decreases in adult life. p27kip1-stmn1 3 5 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey direct interaction direct interaction S4 A Stathmin and p27 associated in adult pork brain cdkn1b-stmn1-1 1 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association S4 B Stathmin and p27 associated in adult pork brain, in mouse fibroblasts adherent to FN but not in serum-starved cells This interaction occurred in mouse fibroblasts adherent to fibronectin. This interaction did not occur in serum-starved mouse fibroblasts.