IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. Cancer Res. (0008-5472) 2004 Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer Cancer Res. (0008-5472) 2004 IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. Cancer Res. (0008-5472) 2004 Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer Cancer Res. (0008-5472) 2004 IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. Cancer Res. (0008-5472) 2004 Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer A wound was made in the cell layer to generate motile cells prior to fixation. Cancer Res. (0008-5472) 2004 IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. Cancer Res. (0008-5472) 2004 Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer in vitro In vitro pull down pull down protein sequence protein sequence identification protein sequence Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer Cancer Res. (0008-5472) 2004 IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. Cancer Res. (0008-5472) 2004 Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer Cancer Res. (0008-5472) 2004 IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. Cancer Res. (0008-5472) 2004 Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer in vitro In vitro pull down pull down predetermined predetermined participant predetermined Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer revisit when electrophoresis in place Interacting proteins are detected by coomassie blue after SDS-PAGE. Cancer Res. (0008-5472) 2004 IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. IRSp53/Eps8 complex is important for positive regulation of Rac and cancer cell motility/invasiveness. Cancer Res. (0008-5472) 2004 Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Funato Y., Terabayashi T., Suenaga N., Seiki M., Takenawa T., Miki H. Cancer - Interactions investigated in the context of cancer Cancer Res. (0008-5472) 2004 eps8_mouse Epidermal growth factor receptor kinase substrate 8 Eps8 protein protein mouse Mus musculus Mouse MNGHMSNRSSGYGVYPSQLNGYGSSPPYSQMDREHSSRTSAKALYEQRKNYARDSVSSVSDVSQYRVEHLTTFVLDRKDAMITVEDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTISHCQAVVHACSYDSILALVCKEPTQSKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPEALRMIAKADPGIPPPPRAPAPVPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKSKKSKRKGPGEGVLTLRAKPPPPDEFVDCFQKFKHGFNLLAKLKSHIQNPSASDLVHFLFTPLNMVVQATGGPELASSVLSPLLTKDTVDFLNYTATAEERKLWMSLGDSWVKVRAEWPKEQFIPPYVPRFRNGWEPPMLNFMGAPTEQDMYQLAESVANAEHQRKQDSKRLSTEHSNVSDYPPADGYAYSSSMYHRGPHADHGEAAMPFKSTPNHQVDRNYDAVKTQPKKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPESGVGRADPPYTHTIQKQRTEYGLRSADTPSAPSPPPTPAPVPVPLPPSVPAPVSVPKVPANVTRQNSSSSDSGGSIVRDSQRYKQLPVDRRKSQMEEVQDELFQRLTIGRSAAQRKFHVPRQNVPVINITYDSSPEEVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRSVCPEGARVFNQITVQKAALEDSNGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH DIP protein Q08509 original sequence version: 92 DIP protein Q08509 original sequence version: 106 50F691FAC3EF1304 baip2_human Brain-specific angiogenesis inhibitor 1-associated protein 2 Insulin receptor substrate protein of 53 kDa Insulin receptor substrate p53/p58 Fas ligand-associated factor 3 BAIAP2 protein protein human Homo sapiens Human MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR DIP protein Q9UQB8 original sequence version: 87 3B9EDC6405DCC99D abi1_human Abl interactor 1 ABI1 SSH3BP1 Abelson interactor 1 Spectrin SH3 domain-binding protein 1 Eps8 SH3 domain-binding protein e3B1 Nap1-binding protein Abl-binding protein 4 protein protein human Homo sapiens Human MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQKPPSPPMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSSSIGIPIAVPTPSPPTIGPENISVPPPSGAPPAPPLAPLLPVSTVIAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVDYEDEEAAVVQYNDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDDGWYEGVCNRVTGLFPGNYVESIMHYTD 2D76F305934127CB eps8_human Epidermal growth factor receptor kinase substrate 8 EPS8 protein protein human Homo sapiens Human MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQNPSAADLVHFLFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEWPKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPPYTHTIQKQRMEYGPRPADTPPAPSPPPTPAPVPVPLPPSTPAPVPVSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQKAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH DIP protein Q12929 original sequence version: 88 DIP protein Q12929 original sequence version: 125 DIP protein Q12929 original sequence version: 109 DIP protein Q12929 original sequence version: 99 AC5EB1D28B784B3B irsp53-eps8-1 4 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey 35s radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells physical association physical association irsp53-eps8-2 4 11 unspecified role unspecified role prey prey 35s radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association irsp53-eps8-3 4 9 unspecified role unspecified role bait bait c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey 35s radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 physical association physical association irsp53-eps8-4 4 9 unspecified role unspecified role bait bait c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey 35s radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-a_431 Homo sapiens epidermoid carcinoma a_431 Human epidermoid carcinoma physical association physical association irsp53-eps8-5 1 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells physical association physical association irsp53-eps8-6 2 9 unspecified role unspecified role bait bait sh3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association irsp53-eps8-7 2 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 9 unspecified role unspecified role bait bait c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association irsp53-eps8-8 6 8 unspecified role unspecified role prey prey prolin-rich region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association abi1-eps8-5 5 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait physical association physical association overexpression of IRSp53 increases the amount of Eps8 co-immunoprecipitated with Abi1. abi1-irsp53-1 5 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association IRSp53 and Eps8 are overexpressed in this experiment. irsp53-eps8-9 6 8 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined prolin-rich region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association irsp53-eps8-10 7 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells physical association physical association irsp53-eps8-11 3 8 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept prolin-rich region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role fluorescence donor fluorescence donor cfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 89 85 direct interaction direct interaction FRET is detected at leading edge of the motile cells