IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Using yeast two-hybrid system to identify ECRG2 associated proteins and their possible interactions with ECRG2 gene. Using yeast two-hybrid system to identify ECRG2 associated proteins and their possible interactions with ECRG2 gene. World J. Gastroenterol. (1007-9327) 2003 Cui YP., Wang JB., Zhang XY., Bi MX., Guo LP., Lu SH. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with ferritin and hemoglobin. shlu@public.bta.net.cn 07-Aug-2007: Contacted by JYOTI. A human fetal liver cDNA library was used. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cui YP., Wang JB., Zhang XY., Bi MX., Guo LP., Lu SH. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with ferritin and hemoglobin. shlu@public.bta.net.cn Accepted 2007-JUL-27 by JYOTI. A human fetal liver cDNA library was used. World J. Gastroenterol. (1007-9327) 2003 Using yeast two-hybrid system to identify ECRG2 associated proteins and their possible interactions with ECRG2 gene. Using yeast two-hybrid system to identify ECRG2 associated proteins and their possible interactions with ECRG2 gene. World J. Gastroenterol. (1007-9327) 2003 Cui YP., Wang JB., Zhang XY., Bi MX., Guo LP., Lu SH. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with ferritin and hemoglobin. shlu@public.bta.net.cn 07-Aug-2007: Contacted by JYOTI. A human fetal liver cDNA library was used. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cui YP., Wang JB., Zhang XY., Bi MX., Guo LP., Lu SH. Cancer - Interactions investigated in the context of cancer A unique UniProtKB entry could not be associated with ferritin and hemoglobin. shlu@public.bta.net.cn Accepted 2007-JUL-27 by JYOTI. 07-Aug-2007: Contacted by JYOTI. A human fetal liver cDNA library was used. World J. Gastroenterol. (1007-9327) 2003 isk7_human Serine protease inhibitor Kazal-type 7 Esophagus cancer-related gene 2 protein SPINK7 ECG2 UNQ745/PRO1474 protein protein human Homo sapiens Human MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC AE861AC8E1EA07D3 mt1h_human Metallothionein-1H MT1H Metallothionein-IH Metallothionein-0 protein protein human Homo sapiens Human MDPNCSCEAGGSCACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCICKGASEKCSCCA 03D866E4F437A2CC q8izw4_human protein protein human Homo sapiens Human RRARCWHKAPERQRQGLKPGFSWAGADAQSGVGSCHLGNCWDLQSQRCHLHSMVLILPASWPEGHPDHKSGGLSVCLHLPQRCLLSFPTHSSLFGVRGGTGQLAQDLLIIAAQVFE B48F55470F01DBB0 rt12_human 28S ribosomal protein S12, mitochondrial MT-RPS12 MRPS12 RPMS12 RPSM12 Mitochondrial small ribosomal subunit protein uS12m protein protein human Homo sapiens Human MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK 893FD2CA1C7187A7 mt2_human Metallothionein-2 Metallothionein-II Metallothionein-2A MT2A CES1 MT2 protein protein human Homo sapiens Human MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA 7B0A7E1F99843078 rabl6_human Rab-like protein 6 RABL6 C9orf86 GTP-binding protein Parf PARF Partner of ARF Rab-like protein 1 protein protein human Homo sapiens Human MFSALKKLVGSDQAPGRDKNIPAGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIDNLDRPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQLDMDATLEELSVQQETEDQNYGIFLEMMEARSRGHASPLAANGQSPSPGSQSPVVPAGAVSTGSSSPGTPQPAPQLPLNAAPPSSVPPVPPSEALPPPACPSAPAPRRSIISRLFGTSPATEAAPPPPEPVPAAEGPATVQSVEDFVPDDRLDRSFLEDTTPARDEKKVGAKAAQQDSDSDGEALGGNPMVAGFQDDVDLEDQPRGSPPLPAGPVPSQDITLSSEEEAEVAAPTKGPAPAPQQCSEPETKWSSIPASKPRRGTAPTRTAAPPWPGGVSVRTGPEKRSSTRPPAEMEPGKGEQASSSESDPEGPIAAQMLSFVMDDPDFESEGSDTQRRADDFPVRDDPSDVTDEDEGPAEPPPPPKLPLPAFRLKNDSDLFGLGLEEAGPKESSEEGKEGKTPSKEKKKKKKKGKEEEEKAAKKKSKHKKSKDKEEGKEERRRRQQRPPRSRERTAADELEAFLGGGAPGGRHPGGGDYEEL 6C3FDB38C7FD7D59 epb42_human Protein 4.2 EPB42 E42P Erythrocyte membrane protein band 4.2 protein protein human Homo sapiens Human MGQALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVRAFLPALKKVALTAQTGEQPSKINRTQATFPISSLGDRKWWSAVVEERDAQSWTISVTTPADAVIGHYSLLLQVSGRKQLLLGQFTLLFNPWNREDAVFLKNEAQRMEYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLRLLSKDKQVEKWSQPVHVARVLGALLHFLKEQRVLPTPQTQATQEGALLNKRRGSVPILRQWLTGRGRPVYDGQAWVLAAVACTVLRCLGIPARVVTTFASAQGTGGRLLIDEYYNEEGLQNGEGQRGRIWIFQTSTECWMTRPALPQGYDGWQILHPSAPNGGGVLGSCDLVPVRAVKEGTLGLTPAVSDLFAAINASCVVWKCCEDGTLELTDSNTKYVGNNISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPPSLETASPLYLLLKAPSSLPLRGDAQISVTLVNHSEQEKAVQLAIGVQAVHYNGVLAAKLWRKKLHLTLSANLEKIITIGLFFSNFERNPPENTFLRLTAMATHSESNLSCFAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELSA 38225C311E478580 mt1g_human Metallothionein-1G Metallothionein-IG Metallothionein-1K MT1G MT1K MT1M protein protein human Homo sapiens Human MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA A1B390F5899DD040 spink7-mt2a-4 1 7 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 2, Table 1 BAIT gene AF268198 spink7-mt1h-1 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 2, Table 1 BAIT gene AF268198 spink7-mt1g-1 1 10 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 2, Table 1 BAIT gene AF268198 spink7-epb42 1 3 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 2, Table 1 BAIT gene AF268198 spink7-mrps12-1 1 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 2, Table 1 BAIT gene AF268198 spink7-q8izw4-1 1 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 2, Table 1 BAIT gene AF268198; PREY gene AF422192 spink7-mt1h-2 2 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association BAIT gene AF268198 spink7-mt2a-5 2 7 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association BAIT gene AF268198 spink7-mt1g-2 2 3 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association BAIT gene AF268198 spink7-epb42-1 2 3 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association BAIT gene AF268198 spink7-mrps12-2 2 3 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association BAIT gene AF268198 spink7-q8izw4-2 2 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association BAIT gene AF268198; PREY gene AF422192 spink7-parf-1 1 8 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 2, Table 1 BAIT gene AF268198 Bernd: replaced fragment Q9NWD6/FLJ10101 (not integrated in SP) by Q3YEC7 (seq identity). spink7-parf-2 2 8 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association BAIT gene AF268198 Bernd: replaced fragment Q9NWD6/FLJ10101 (not integrated in SP) by Q3YEC7 (seq identity).