IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A yeast two-hybrid assay provides a simple way to evaluate the vast majority of hMLH1 germ-line mutations. A yeast two-hybrid assay provides a simple way to evaluate the vast majority of hMLH1 germ-line mutations. Cancer research 2003 imex curation Kondo E., Suzuki H., Horii A., Fukushige S. Rare diseases - Interactions investigated in the context of Rare genetic disease Cancer - Interactions investigated in the context of cancer EMSA not curated as the interaction in with no biological relevance (LexA tag- LexA operator) shinichi@mail.cc.tohoku.ac.jp 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Kondo E., Suzuki H., Horii A., Fukushige S. Rare diseases - Interactions investigated in the context of Rare genetic disease Cancer - Interactions investigated in the context of cancer EMSA not curated as the interaction in with no biological relevance (LexA tag- LexA operator) shinichi@mail.cc.tohoku.ac.jp Accepted 2019-NOV-05 AT 16:27 GMT AT 16:27 GMT by MGT Cancer research 2003 Only protein-protein interactions imex curation imex curation A yeast two-hybrid assay provides a simple way to evaluate the vast majority of hMLH1 germ-line mutations. A yeast two-hybrid assay provides a simple way to evaluate the vast majority of hMLH1 germ-line mutations. Cancer research 2003 imex curation Kondo E., Suzuki H., Horii A., Fukushige S. Rare diseases - Interactions investigated in the context of Rare genetic disease Cancer - Interactions investigated in the context of cancer EMSA not curated as the interaction in with no biological relevance (LexA tag- LexA operator) shinichi@mail.cc.tohoku.ac.jp 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kondo E., Suzuki H., Horii A., Fukushige S. Rare diseases - Interactions investigated in the context of Rare genetic disease Cancer - Interactions investigated in the context of cancer EMSA not curated as the interaction in with no biological relevance (LexA tag- LexA operator) shinichi@mail.cc.tohoku.ac.jp Accepted 2019-NOV-05 AT 16:27 GMT AT 16:27 GMT by MGT Cancer research 2003 Only protein-protein interactions imex curation imex curation exo1_human Exonuclease 1 EXO1 EXOI HEX1 Exonuclease I protein protein human Homo sapiens Human MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHGIKPILVFDGCTLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQGVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARLGMCRQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANNTFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDDSIALQIALGNKDINTFEQIDDYNPDTAMPAHSRSHSWDDKTCQKSANVSSIWHRNYSPRPESGTVSDAPQLKENPSTVGVERVISTKGLNLPRKSSIVKRPRSAELSEDDLLSQYSLSFTKKTKKNSSEGNKSLSFSEVFVPDLVNGPTNKKSVSTPPRTRNKFATFLQRKNEESGAVVVPGTRSRFFCSSDSTDCVSNKVSIQPLDETAVTDKENNLHESEYGDQEGKRLVDTDVARNSSDDIPNNHIPGDHIPDKATVFTDEESYSFESSKFTRTISPPTLGTLRSCFSWSGGLGDFSRTPSPSPSTALQQFRRKSDSPTSLPENNMSDVSQLKSEESSDDESHPLREEACSSQSQESGEFSLQSSNASKLSQCSSKDSDSEESDCNIKLLDSQSDQTSKLRLSHFSKKDTPLRNKVPGLYKSSSADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQ DIP protein Q9UQ84 original sequence version: 120 DIP protein Q9UQ84 original sequence version: 140 850BC21CA9790D08 mlh1_human DNA mismatch repair protein Mlh1 MutL protein homolog 1 MLH1 COCA2 protein protein human Homo sapiens Human MSFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC DIP protein P40692 original sequence version: 99 C9231FC406C2CA20 pms2_human Mismatch repair endonuclease PMS2 PMS1 protein homolog 2 DNA mismatch repair protein PMS2 PMS2 PMSL2 protein protein human Homo sapiens Human MERAESSSTEPAKAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQVETFGFRGEALSSLCALSDVTISTCHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSVFGQKQLQSLIPFVQLPPSDSVCEEYGLSCSDALHNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPAKVCRLVNEVYHMYNRHQYPFVVLNISVDSECVDINVTPDKRQILLQEEKLLLAVLKTSLIGMFDSDVNKLNVSQQPLLDVEGNLIKMHAADLEKPMVEKQDQSPSLRTGEEKKDVSISRLREAFSLRHTTENKPHSPKTPEPRRSPLGQKRGMLSSSTSGAISDKGVLRPQKEAVSSSHGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSEYAASSPGDRGSQEHVDSQEKAPKTDDSFSDVDCHSNQEDTGCKFRVLPQPTNLATPNTKRFKKEEILSSSDICQKLVNTQDMSASQVDVAVKINKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAAEDELRKEISKTMFAEMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAVNEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLSDSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHPWNCPHGRPTMRHIANLGVISQN B1B9547280ECAF9A pms2-mlh1-1 2 4 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p.Leu166Phefs*6 p.Leu166Phefs*6 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC FKKSK p.Gly174Trpfs*18 p.Gly174Trpfs*18 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain GKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC WENFGSCWQVFSTQCRH p.Gly181Alafs*21 p.Gly181Alafs*21 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain GRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC AGIQYTMQALVSQLKNKERQ p.Lys196Thrfs*8 p.Lys196Thrfs*8 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain KQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC TTRRDSS p.Gln197Argfs*6 p.Gln197Argfs*6 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain QGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC RRDSS p.Glu199Aspfs*4 p.Glu199Aspfs*4 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain ETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC DSS p.Thr212Profs*17 p.Thr212Profs*17 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain TVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC PWTIFAPSLEMLLVEN p.Arg659* p.Arg659* mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain RLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC . p.Trp712* p.Trp712* mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain WKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC . p.Trp714* p.Trp714* mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain WTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC . p.Met242Ilefs*64 p.Met242Ilefs*64 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain MNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC IWLHIQCKLLSEEVHLLTLHQPSSGRINFLEKSHRNSVCSLFAQKHTPIPVPQFRNQSPECGC p.Tyr245* p.Tyr245* mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain YISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC . p.Val253Cysfs*55 p.Val253Cysfs*55 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain VKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC CCEEVHLLTLHQPSSGRINFLEKSHRNSVCSLFAQKHTPIPVPQFRNQSPECGC p.Leu166* required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P40692:p.Pro28Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P L Tue Jun 30 18:20:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro28Leu' P40692:p.Met35Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain M R Tue Jun 30 16:48:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met35Arg' P40692:p.Ser44Phe mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S F Tue Jun 30 17:39:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser44Phe' P40692:p.Gly67Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 19:02:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly67Arg' P40692:p.Ile68Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I N Tue Jun 30 17:51:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile68Asn' P40692:p.Cys77Tyr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C Y Tue Jun 30 18:36:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys77Tyr' P40692:p.Ile107Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I R Tue Jun 30 17:19:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile107Arg' P40692:p.Thr117Met mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T M Tue Jun 30 15:53:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr117Met' P40692:p.Thr117Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T R Tue Jun 30 19:10:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr117Arg' P40692:p.Ala128Pro mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A P Tue Jun 30 16:32:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala128Pro' P40692:p.Val185Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V G Tue Jun 30 16:33:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val185Gly' P40692:p.Gly244Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 18:59:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly244Asp' P40692:p.Val326Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V A Tue Jun 30 18:50:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val326Ala' P40692:p.Ala492Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A T Tue Jun 30 20:20:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala492Thr' P40692:p.Val506Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V A Tue Jun 30 20:12:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val506Ala' P40692:p.Gln542Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 17:49:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln542Leu' P40692:p.Leu574Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 18:50:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu574Pro' P40692:p.Glu578Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E G Tue Jun 30 16:26:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu578Gly' P40692:p.Leu582Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L V Tue Jun 30 15:57:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu582Val' P40692:p.Lys618Thr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K T Tue Jun 30 16:17:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys618Thr' P40692:p.Lys618Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 16:59:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys618Ala' P40692:p.Arg659Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R P Tue Jun 30 18:38:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg659Pro' P40692:p.Ala681Thr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A T Tue Jun 30 19:24:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala681Thr' P40692:p.Lys616del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Tue Jun 30 17:27:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys616del' rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 5 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 2 pms2-mlh1-3 1 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P40692:p.Pro28Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain P L Tue Jun 30 17:10:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro28Leu' P40692:p.Met35Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M R Tue Jun 30 17:38:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met35Arg' P40692:p.Ser44Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S F Tue Jun 30 16:14:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser44Phe' P40692:p.Gly67Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 18:18:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly67Arg' P40692:p.Ile68Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I N Tue Jun 30 20:08:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile68Asn' P40692:p.Cys77Tyr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C Y Tue Jun 30 20:18:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys77Tyr' P40692:p.Ile107Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I R Tue Jun 30 15:40:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile107Arg' P40692:p.Thr117Met mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T M Tue Jun 30 17:14:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr117Met' P40692:p.Thr117Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T R Tue Jun 30 15:39:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr117Arg' P40692:p.Ala128Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A P Tue Jun 30 19:40:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala128Pro' P40692:p.Val185Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V G Tue Jun 30 17:25:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val185Gly' P40692:p.Gly244Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 18:56:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly244Asp' P40692:p.Val326Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V A Tue Jun 30 16:01:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val326Ala' P40692:p.Ala492Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A T Tue Jun 30 17:59:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala492Thr' P40692:p.Val506Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V A Tue Jun 30 19:20:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val506Ala' P40692:p.Gln542Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 18:06:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln542Leu' P40692:p.Leu574Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 19:30:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu574Pro' P40692:p.Glu578Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E G Tue Jun 30 17:30:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu578Gly' P40692:p.Leu582Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L V Tue Jun 30 16:07:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu582Val' P40692:p.Lys618Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K T Tue Jun 30 16:18:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys618Thr' P40692:p.Lys618Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 17:39:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys618Ala' P40692:p.Arg659Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R P Tue Jun 30 16:56:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg659Pro' P40692:p.Ala681Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A T Tue Jun 30 18:12:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala681Thr' P40692:p.Lys616del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Wed Nov 13 13:26:59 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys616del' Tue Jun 30 19:41:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys616del' P40692:p.Ile32Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I V Tue Jun 30 16:10:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile32Val' P40692:p.Val213Met mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V M Tue Jun 30 16:00:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val213Met' P40692:p.Arg217Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 18:28:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg217Cys' P40692:p.Ile219Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I V Tue Jun 30 17:40:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile219Val' P40692:p.Ile219Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I L Tue Jun 30 20:15:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile219Leu' P40692:p.Arg265His mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 16:26:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg265His' P40692:p.Ser406Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S N Tue Jun 30 16:23:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser406Asn' P40692:p.His718Tyr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H Y Tue Jun 30 19:21:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His718Tyr' P40692:p.Leu729Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L V Tue Jun 30 19:45:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu729Val' 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Table 1 exo1-mlh1-4 1 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P40692:p.Pro28Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain P L Tue Jun 30 15:37:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro28Leu' P40692:p.Met35Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M R Tue Jun 30 17:23:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met35Arg' P40692:p.Ser44Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S F Tue Jun 30 18:30:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser44Phe' P40692:p.Gly67Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 18:42:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly67Arg' P40692:p.Ile68Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I N Tue Jun 30 16:07:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile68Asn' P40692:p.Cys77Tyr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C Y Tue Jun 30 17:39:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys77Tyr' P40692:p.Ile107Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I R Tue Jun 30 15:44:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile107Arg' P40692:p.Thr117Met mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T M Tue Jun 30 19:30:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr117Met' P40692:p.Thr117Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T R Tue Jun 30 17:32:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr117Arg' P40692:p.Ala128Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A P Tue Jun 30 18:21:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala128Pro' P40692:p.Val185Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V G Tue Jun 30 15:58:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val185Gly' P40692:p.Gly244Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 20:08:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly244Asp' P40692:p.Val326Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V A Tue Jun 30 19:35:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val326Ala' P40692:p.Ala492Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A T Tue Jun 30 17:26:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala492Thr' P40692:p.Val506Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain V A Tue Jun 30 17:16:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val506Ala' P40692:p.Gln542Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 16:25:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln542Leu' P40692:p.Leu574Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 18:30:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu574Pro' P40692:p.Glu578Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E G Tue Jun 30 15:39:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu578Gly' P40692:p.Leu582Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L V Tue Jun 30 19:04:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu582Val' P40692:p.Lys618Thr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K T Tue Jun 30 16:06:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys618Thr' P40692:p.Lys618Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 19:01:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys618Ala' P40692:p.Arg659Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R P Tue Jun 30 16:24:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg659Pro' P40692:p.Ala681Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A T Tue Jun 30 20:20:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala681Thr' P40692:p.Lys616del mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K . Wed Nov 13 12:51:48 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys616del' Tue Jun 30 19:56:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys616del' P40692:p.Ile32Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I V Tue Jun 30 18:40:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile32Val' P40692:p.Val213Met mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V M Tue Jun 30 18:53:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val213Met' P40692:p.Arg217Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 19:20:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg217Cys' P40692:p.Ile219Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I V Tue Jun 30 16:44:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile219Val' P40692:p.Ile219Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I L Tue Jun 30 16:25:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile219Leu' P40692:p.Arg265His mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 17:36:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg265His' P40692:p.Ser406Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S N Tue Jun 30 17:05:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser406Asn' P40692:p.His718Tyr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H Y Tue Jun 30 19:39:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His718Tyr' P40692:p.Leu729Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L V Tue Jun 30 17:33:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu729Val' 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Table 1 mlh1-pms2-5 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed p.Arg659* p.Arg659* mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC . p.Leu166* p.Leu166* required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain LKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC . p.Trp712* p.Trp712* mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain WKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC . p.Trp714* p.Trp714* mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain WTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC . p.Leu166Phefs*6 p.Leu166Phefs*6 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain LKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC FKKSK p.Gly174Trpfs*18 p.Gly174Trpfs*18 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain GKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC WENFGSCWQVFSTQCRH p.Gly181Alafs*21 p.Gly181Alafs*21 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain GRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC AGIQYTMQALVSQLKNKERQ p.Lys196Thrfs*8 p.Lys196Thrfs*8 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain KQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC TTRRDSS p.Gln197Argfs*6 p.Gln197Argfs*6 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain QGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC RRDSS p.Glu199Aspfs*4 p.Glu199Aspfs*4 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain ETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC DSS p.Thr212Profs*17 p.Thr212Profs*17 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain TVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC PWTIFAPSLEMLLVEN p.Met242Ilefs*64 p.Met242Ilefs*64 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain MNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC IWLHIQCKLLSEEVHLLTLHQPSSGRINFLEKSHRNSVCSLFAQKHTPIPVPQFRNQSPECGC p.Tyr245* p.Tyr245* mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain YISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC . p.Val253Cysfs*55 p.Val253Cysfs*55 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain VKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC CCEEVHLLTLHQPSSGRINFLEKSHRNSVCSLFAQKHTPIPVPQFRNQSPECGC P40692:p.Met35Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M R Tue Jun 30 17:04:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met35Arg' P40692:p.Ser44Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S F Tue Jun 30 18:13:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser44Phe' P40692:p.Gly67Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G R Tue Jun 30 20:05:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly67Arg' P40692:p.Ile68Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I N Tue Jun 30 20:14:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile68Asn' P40692:p.Cys77Tyr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C Y Tue Jun 30 16:57:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys77Tyr' P40692:p.Ile107Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I R Tue Jun 30 16:00:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile107Arg' P40692:p.Thr117Met mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T M Tue Jun 30 18:28:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr117Met' P40692:p.Thr117Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T R Tue Jun 30 18:53:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr117Arg' P40692:p.Ala128Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A P Tue Jun 30 18:18:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala128Pro' P40692:p.Val185Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V G Tue Jun 30 17:09:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val185Gly' P40692:p.Gly244Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 18:58:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly244Asp' P40692:p.Val326Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V A Tue Jun 30 17:10:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val326Ala' P40692:p.Ala492Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A T Tue Jun 30 16:53:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala492Thr' P40692:p.Val506Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V A Tue Jun 30 16:21:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val506Ala' P40692:p.Gln542Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 17:47:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln542Leu' P40692:p.Leu574Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 17:52:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu574Pro' P40692:p.Glu578Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E G Tue Jun 30 19:35:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu578Gly' P40692:p.Leu582Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L V Tue Jun 30 18:02:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu582Val' P40692:p.Lys618Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K T Tue Jun 30 19:02:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys618Thr' P40692:p.Lys618Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 15:48:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys618Ala' P40692:p.Arg659Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R P Tue Jun 30 18:34:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg659Pro' P40692:p.Ala681Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A T Tue Jun 30 19:57:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala681Thr' P40692:p.Lys616del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K . Wed Nov 13 15:00:58 GMT 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys616del' Tue Jun 30 20:09:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys616del' P40692:p.Ile32Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I V Tue Jun 30 19:31:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile32Val' P40692:p.Val213Met mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V M Tue Jun 30 16:41:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val213Met' P40692:p.Arg217Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R C Tue Jun 30 20:14:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg217Cys' P40692:p.Ile219Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I V Tue Jun 30 20:10:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile219Val' P40692:p.Ile219Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I L Tue Jun 30 18:13:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile219Leu' P40692:p.Arg265His mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 17:54:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg265His' P40692:p.Ser406Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S N Tue Jun 30 18:15:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser406Asn' P40692:p.His718Tyr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H Y Tue Jun 30 16:18:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His718Tyr' P40692:p.Leu729Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L V Tue Jun 30 17:21:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu729Val' 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Table 1