IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Carcinogenesis and translational controls: TACC1 is down-regulated in human cancers and associates with mRNA regulators. Carcinogenesis and translational controls: TACC1 is down-regulated in human cancers and associates with mRNA regulators. Oncogene (0950-9232) 2002 imex curation Conte N., Charafe-Jauffret E., Delaval B., Adelaide J., Ginestier C., Geneix J., Isnardon D., Jacquemier J., Birnbaum D. Cancer - Interactions investigated in the context of cancer birnbaum@marseille.inserm.fr 12-Oct-2007: Contacted by JYOTI. A human mammary gland cDNA expression library was used. Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Conte N., Charafe-Jauffret E., Delaval B., Adelaide J., Ginestier C., Geneix J., Isnardon D., Jacquemier J., Birnbaum D. Cancer - Interactions investigated in the context of cancer birnbaum@marseille.inserm.fr Accepted 2007-OCT-25 by JYOTI. 12-Oct-2007: Contacted by JYOTI. A human mammary gland cDNA expression library was used. Oncogene (0950-9232) 2002 Only protein-protein interactions imex curation Carcinogenesis and translational controls: TACC1 is down-regulated in human cancers and associates with mRNA regulators. Carcinogenesis and translational controls: TACC1 is down-regulated in human cancers and associates with mRNA regulators. Oncogene (0950-9232) 2002 imex curation Conte N., Charafe-Jauffret E., Delaval B., Adelaide J., Ginestier C., Geneix J., Isnardon D., Jacquemier J., Birnbaum D. Cancer - Interactions investigated in the context of cancer birnbaum@marseille.inserm.fr 12-Oct-2007: Contacted by JYOTI. A human mammary gland cDNA expression library was used. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Conte N., Charafe-Jauffret E., Delaval B., Adelaide J., Ginestier C., Geneix J., Isnardon D., Jacquemier J., Birnbaum D. Cancer - Interactions investigated in the context of cancer birnbaum@marseille.inserm.fr Accepted 2007-OCT-25 by JYOTI. 12-Oct-2007: Contacted by JYOTI. A human mammary gland cDNA expression library was used. Oncogene (0950-9232) 2002 Only protein-protein interactions imex curation Carcinogenesis and translational controls: TACC1 is down-regulated in human cancers and associates with mRNA regulators. Carcinogenesis and translational controls: TACC1 is down-regulated in human cancers and associates with mRNA regulators. Oncogene (0950-9232) 2002 imex curation Conte N., Charafe-Jauffret E., Delaval B., Adelaide J., Ginestier C., Geneix J., Isnardon D., Jacquemier J., Birnbaum D. Cancer - Interactions investigated in the context of cancer birnbaum@marseille.inserm.fr 12-Oct-2007: Contacted by JYOTI. A human mammary gland cDNA expression library was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Conte N., Charafe-Jauffret E., Delaval B., Adelaide J., Ginestier C., Geneix J., Isnardon D., Jacquemier J., Birnbaum D. Cancer - Interactions investigated in the context of cancer birnbaum@marseille.inserm.fr Accepted 2007-OCT-25 by JYOTI. A human mammary gland cDNA expression library was used. Oncogene (0950-9232) 2002 Only protein-protein interactions imex curation Carcinogenesis and translational controls: TACC1 is down-regulated in human cancers and associates with mRNA regulators. Carcinogenesis and translational controls: TACC1 is down-regulated in human cancers and associates with mRNA regulators. Oncogene (0950-9232) 2002 imex curation Conte N., Charafe-Jauffret E., Delaval B., Adelaide J., Ginestier C., Geneix J., Isnardon D., Jacquemier J., Birnbaum D. Cancer - Interactions investigated in the context of cancer birnbaum@marseille.inserm.fr 12-Oct-2007: Contacted by JYOTI. A human mammary gland cDNA expression library was used. Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Conte N., Charafe-Jauffret E., Delaval B., Adelaide J., Ginestier C., Geneix J., Isnardon D., Jacquemier J., Birnbaum D. Cancer - Interactions investigated in the context of cancer birnbaum@marseille.inserm.fr Accepted 2007-OCT-25 by JYOTI. 12-Oct-2007: Contacted by JYOTI. A human mammary gland cDNA expression library was used. Oncogene (0950-9232) 2002 Only protein-protein interactions imex curation o75410-6 Transforming acidic coiled-coil-containing protein 1 Short TACC1-S TACC1 KIAA1103 Gastric cancer antigen Ga55 Taxin-1 protein protein human Homo sapiens Human MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFRSGCKVKKHETQSLALDACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVPVSTINHAFSSSEAGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIEANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESAALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD B29F0EA1DCAAF8E1 ruxg_human Small nuclear ribonucleoprotein G SNRPG PBSCG Sm protein G protein protein human Homo sapiens Human MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV DIP protein P62308 original sequence version: 69 DIP protein P62308 original sequence version: 92 DIP protein P62308 original sequence version: 78 DIP protein P62308 original sequence version: 126 623302BF6BE758FE o75410-1 Transforming acidic coiled-coil-containing protein 1 A Long TACC1-A TACC1 KIAA1103 Gastric cancer antigen Ga55 Taxin-1 protein protein human Homo sapiens Human MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGNFETPEAETPIRSPFKESCDPSLGLAGPGAKSQESQEADEQLVAEVVEKCSSKTCSKPSENEVPQQAIDSHSVKNFREEPEHDFSKISIVRPFSIETKDSTDISAVLGTKAAHGCVTAVSGKALPSSPPDALQDEAMTEGSMGVTLEASAEADLKAGNSCPELVPSRRSKLRKPKPVPLRKKAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLGDARFQKSPPDLKETPGTLSSDTNDSGVELGEESRSSPLKLEFDFTEDTGNIEARKALPRKLGRKLGSTLTPKIQKDGISKSAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSHSVLQNSPPLSSEGSYHFDPDNFDESMDPFKPTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALDACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVPVSTINHAFSSSEAGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIEANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKGVLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESAALHAGLRKEQMKVESLERALQQKNQEIEELTKICDELIAKLGKTD 3A261EF58C165107 lsm7_human U6 snRNA-associated Sm-like protein LSm7 LSM7 protein protein human Homo sapiens Human MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA DIP protein Q9UK45 original sequence version: 87 7429DC0FB365C9C8 tacc1-lsm7 3 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association we used the two-hybrid system in yeast to isolate potential TACC1 partners. We screened a human mammary gland cDNA expression library with the 805 amino-acid residues of human TACC1l fused to the Gal4-binding domain. We isolated 10 cDNA clones. Eight encoded the 103 amino-acids of the LSM7 protein and two encoded the 76 amino-acids of the snRNP Sm protein G tacc1-snrpg 3 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association we used the two-hybrid system in yeast to isolate potential TACC1 partners. We screened a human mammary gland cDNA expression library with the 805 amino-acid residues of human TACC1l fused to the Gal4-binding domain. We isolated 10 cDNA clones. Eight encoded the 103 amino-acids of the LSM7 protein and two encoded the 76 amino-acids of the snRNP Sm protein G lsm7-tacc1 2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association 6 A Both GST-LSM7 and GST-SmG fusion proteins were able to precipitate TACC1l snrpg-tacc1 2 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 6 A Both GST-LSM7 and GST-SmG fusion proteins were able to precipitate TACC1l tacc1-lsm7-3 4 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 B proteins from Cos-1 cells cotransfected by HA-tagged TACC1l with myc-tagged LSM7 or Myc-tagged SmG were immunoprecipitated with either anti-myc or anti-TACC1-C antibody and Western blotted. In both cases, blotting with the anti-HA antibody revealed TACC1l protein and blotting with the myc antibody revealed LSM7 or SmG. Q9UK45; O75410-1 transfection lsm7-tacc1-1 1 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 B proteins from Cos-1 cells cotransfected by HA-tagged TACC1l with myc-tagged LSM7 or Myc-tagged SmG were immunoprecipitated with either anti-myc or anti-TACC1-C antibody and Western blotted. In both cases, blotting with the anti-HA antibody revealed TACC1l protein and blotting with the myc antibody revealed LSM7 or SmG. Q9UK45; O75410-1 transfection tacc1-snrpg-3 4 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 B proteins from Cos-1 cells cotransfected by HA-tagged TACC1l with myc-tagged LSM7 or myc-tagged SmG were immunoprecipitated with either anti-myc or anti-TACC1l-C antibody and Western blotted. In both cases, blotting with the anti-HA antibody revealed LSM or SmG P62308; O75410-1 transfection snrpg-tacc1-1 1 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 B proteins from Cos-1 cells cotransfected by HA-tagged TACC1l with myc-tagged LSM7 or myc-tagged SmG were immunoprecipitated with either anti-myc or anti-TACC1l-C antibody and Western blotted. In both cases, blotting with the anti-HA antibody revealed LSM or SmG P62308; o75410-1 transfection tacc1-snrpg-4 4 5 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 C P62308; O75410-6 transfection Proteins from Cos-1 cells cotransfected with myc-tagged TACC1s and myc-tagged LSM7 or myc-tagged SmG were immunoprecipitated by anti-TACC1-C antibody and Western blotted. Blotting with anti-myc antibody revealed LSM7 or SmG tacc1-lsm7-4 4 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 C Q9UK45; O75410-6 transfection Proteins from Cos-1 cells cotransfected with myc-tagged TACC1s and myc-tagged LSM7 or myc-tagged SmG were immunoprecipitated by anti-TACC1-C antibody and Western blotted. Blotting with anti-myc antibody revealed LSM7 or SmG