IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23. Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23. Biochem. Biophys. Res. Commun. (0006-291X) 2001 imex curation Ohkura N., Kishi M., Tsukada T., Yamaguchi K. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer nohkura@gan2.ncc.go.jp 01-DEC-2006: Contacted by JYOTI. The cDNA library used was made from rat fetal forebrain embryonic day 17 (E17) polyA+ RNA. This is because rat MEN1 expression is strongest in the fetal forebrain at embryonic day 14-18. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ohkura N., Kishi M., Tsukada T., Yamaguchi K. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. nohkura@gan2.ncc.go.jp Accepted 2006-NOV-23 by DAVET. 01-DEC-2006: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Only protein-protein interactions imex curation Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23. Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23. Biochem. Biophys. Res. Commun. (0006-291X) 2001 imex curation Ohkura N., Kishi M., Tsukada T., Yamaguchi K. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer nohkura@gan2.ncc.go.jp 01-DEC-2006: Contacted by JYOTI. The cDNA library used was made from rat fetal forebrain embryonic day 17 (E17) polyA+ RNA. This is because rat MEN1 expression is strongest in the fetal forebrain at embryonic day 14-18. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ohkura N., Kishi M., Tsukada T., Yamaguchi K. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. nohkura@gan2.ncc.go.jp Accepted 2006-NOV-23 by DAVET. 01-DEC-2006: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Only protein-protein interactions imex curation Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23. Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23. Biochem. Biophys. Res. Commun. (0006-291X) 2001 imex curation Ohkura N., Kishi M., Tsukada T., Yamaguchi K. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer nohkura@gan2.ncc.go.jp 01-DEC-2006: Contacted by JYOTI. The cDNA library used was made from rat fetal forebrain embryonic day 17 (E17) polyA+ RNA. This is because rat MEN1 expression is strongest in the fetal forebrain at embryonic day 14-18. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ohkura N., Kishi M., Tsukada T., Yamaguchi K. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. nohkura@gan2.ncc.go.jp Accepted 2006-NOV-23 by DAVET. 01-DEC-2006: Contacted by JYOTI. The cDNA library used was made from rat fetal forebrain embryonic day 17 (E17) polyA+ RNA. This is because rat MEN1 expression is strongest in the fetal forebrain at embryonic day 14-18. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Only protein-protein interactions imex curation Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23. Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23. Biochem. Biophys. Res. Commun. (0006-291X) 2001 imex curation Ohkura N., Kishi M., Tsukada T., Yamaguchi K. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer nohkura@gan2.ncc.go.jp 01-DEC-2006: Contacted by JYOTI. The cDNA library used was made from rat fetal forebrain embryonic day 17 (E17) polyA+ RNA. This is because rat MEN1 expression is strongest in the fetal forebrain at embryonic day 14-18. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ohkura N., Kishi M., Tsukada T., Yamaguchi K. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. nohkura@gan2.ncc.go.jp Accepted 2006-NOV-23 by DAVET. 01-DEC-2006: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Only protein-protein interactions imex curation ndka_rat Nucleoside diphosphate kinase A Tumor metastatic process-associated protein Metastasis inhibition factor NM23 Nme1 protein protein rat Rattus norvegicus (Rat) Rat MANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFIQASEDLLKEHYIDLKDRPFFSGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEISLWFQPEELVDYKSCAQNWIYE 32C49E6271195C3B o00255-2 Menin Short MEN1 SCG2 protein protein human Homo sapiens Human MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRGPRRESKPEEPPPPKKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPTASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL DIP protein O00255-2 original sequence version: 116 9BF844C0302B43EF men1-nme1 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association In the two-hybrid screening of the rat fetal forebrain cDNA library using the full-length MEN1 cDNA as bait, several cDNA clones were obtained. A comparison of the amino acid sequence with known protein sequences revealed that one of them was identical to the nonmetastatic 23b (nm23b; its counterpart in human is called nm23-H1), also known as c-myc regulatory factor PuF and nucleoside diphosphate (NDP) kinase. Although not explicitly stated, it seems the menin protein is human as this protein is discussed in the introduction and the donor of the construct has worked with the human protein. However, they state that the menin protein is 610 residues (this seems to be a predicted length.) whereas the UniprotkB entry is 615 residues. nme1-men1 4 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35S-methionine labeled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role prey prey region 35S-methionine labeled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Although not explicitly stated, it seems the menin protein is human as this protein is discussed in the introduction and the donor of the construct has worked with the human protein. However, they state that the menin protein is 610 residues (this seems to be a predicted length.) whereas the UniprotkB entry is 615 residues. GST-nm23 bound menin 1 A men1-nme1-2 4 5 unspecified role unspecified role prey prey region 35S-methionine labeled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35S-methionine labeled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Although not explicitly stated, it seems the menin protein is human as this protein is discussed in the introduction and the donor of the construct has worked with the human protein. However, they state that the menin protein is 610 residues (this seems to be a predicted length.) whereas the UniprotkB entry is 615 residues. 1 B GST-menin bound nm23 nme1-men1-1 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association Although not explicitly stated, it seems the menin protein is human as this protein is discussed in the introduction and the donor of the construct has worked with the human protein. However, they state that the menin protein is 610 residues (this seems to be a predicted length.) whereas the UniprotkB entry is 615 residues. GST-nm23 bound menin protein expressed in COS-7 cells men1-nme1-1 1 6 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O00255-2:p.Pro12Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P L Wed May 02 14:45:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro12leu' Tue Jun 30 16:31:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro12Leu' O00255-2:p.His139Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H D Wed May 02 19:29:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his139asp' Tue Jun 30 16:03:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His139Asp' O00255-2:p.Pro320Leu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P L Wed May 02 17:21:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro320leu' Tue Jun 30 18:36:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro320Leu' 5 unspecified role unspecified role prey prey physical association physical association 3, 4 Only the constructs lacking the C-terminal region (Men del 1; 1�486 amino acids) showed transcriptional activation of b-gal at low level. Menin constructs truncated beyond residue 486 at the C-terminus and constructs with regions deleted at the N-terminus did not bind nm23. The authors state that this indicates that almost all of the protein is required for binding to nm23. When lys-119 in Menin was deleted this also abolished the interaction with nm23. Revisit this when the new CV is in place and the deletion of lys-119 can be added with the mutation editor.