IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. EMBO J. (0261-4189) 2000 imex curation Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dyjin@hkucc.hku.hk A human liver cDNA library was used Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis 2b dyjin@hkucc.hku.hk Accepted 2006-APR-18 by JYOTI. A human liver cDNA library was used EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. EMBO J. (0261-4189) 2000 imex curation Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dyjin@hkucc.hku.hk A human liver cDNA library was used Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis dyjin@hkucc.hku.hk Accepted 2006-APR-18 by JYOTI. A human liver cDNA library was used EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. EMBO J. (0261-4189) 2000 imex curation Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dyjin@hkucc.hku.hk A human liver cDNA library was used Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis 2c dyjin@hkucc.hku.hk Accepted 2006-APR-18 by JYOTI. A human liver cDNA library was used EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. EMBO J. (0261-4189) 2000 imex curation Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dyjin@hkucc.hku.hk A human liver cDNA library was used Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis 2a and 4 dyjin@hkucc.hku.hk Accepted 2006-APR-18 by JYOTI. A human liver cDNA library was used EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. EMBO J. (0261-4189) 2000 imex curation Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dyjin@hkucc.hku.hk A human liver cDNA library was used Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis 2b dyjin@hkucc.hku.hk Accepted 2006-APR-18 by JYOTI. A human liver cDNA library was used EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation polg_hcvtw Genome polyprotein protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) MSTNGKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTWERSQPRGRRQPIPKARQPEGRAWAQPGYPWPLYGNEGLGWAGWLVSPRGSRPNWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGVARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTIPASAYEVHNVSGIYHVTNDCSNSSIVYEAADMIMHTPGCVPCVRENNSSRCWVALTPTLAARNNSVPTATIRRHVDLLVGAAAFCSAMYVGDLCGSVFLVSQLFTFSPRRYETVQDCNCSIYPGHVTGHRMAWDMMMNWSPTTALVVSQLLRIPQAVVDMVGGAHWGVLAGLAYYSMVGNWAKVLIVMLLFAGVDGSTIVSGGTVARTTHSLASLFTQGASQKIQLINTNGSWHINRTALNCNDSLQTGFLASLFYAHRFNASGCPERMASCRSIDKFDQGWGPITYTEADIQDQRPYCWHYAPRPCGIVPASQVCGPVYCFTPSPVVVGTTDRFGAPTYSWGENETDVLILNNTRPPQGNWFGCTWMNSTGFTKTCGGPPCNIGGGGNNTLVCPTDCFRKHPEATYTKCGSGPWLTPRCMVDYPYRLWHYPCTVNFTIFKVRMYVGGVEHRLNAACNWTRGERCDLEDRDRSELSPLLLSTTEWQILPCSFTGLPALSTGLIHLHQNVVDVQYLYGIGSAVVSFAIKWEYILLLFLLLADARVCACLWMMLLIAQAEAALENLVVFNAASVAGMHGTLSFLVFFCAAWYIKGRLVPGAAYALYGVWPLLLLLLALPPRAYAMDREMAASCGGAVFVGLVLLTLSPHYKMFLARLIWWLQYFITRAEAHLQVWIPPLNVRGGRDAIILLTCAAYPELIFDITKILLAILGPLMVLQAGLTRIPYFVRAQGLIRACMLVRKAAGGHYVQMALMKLAALTGTYVYDHLTPLQDWAHTGLRDLAVAVEPVVFSDMETKIITWGADTAACGDIILGLPVSARRGREILLGPADSLEGRGWRLLAPITAYAQQTRGLFGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWHAPQGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQAFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIMCDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEIALSNTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSALGIHAVAYYRGLDVSVIPASGNVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTMPQDAVSRSQRRGRTSRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLTRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTSTWVLVGGVLAALAAYCLTTGSVVIVGRIILSGKPAVVPDREVLYQEFDEMEECASHLPYIEQGMQLAEQFKQKALGLLQTATKQAEAAAPVVESKWRTLEAFWANDMWNFISGIQYLAGLSTLPGNPAIASLMAFTASITSPLTTQSTLLFNILGGWVAAQLAPPGAASAFVGAGIAGAAVGSIGLGKVLVDMVAGYGAGVAGALVAFKVMSGEMPSTEDLVNLLPAILSPGALVVGVVCAAILRRHVDPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQILSGLTITQLLRRLHQWINEDCSTPCSGSWLRDVWDWICTVLADFKTWLQSKLLPRLPGVPFFSCQRGYKGVWRGDGIMQTTCPCGAQLTGHVKNGSMRIWGPKTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVRRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVSFQVGLNQYVVGSQLPCEPEPDVAVLTSMLTDPSHITAETAKRRLARGSPPSLASSSASQLSALSLKAACTTRHTPPDADLIEANLLWRQEMGGNITRVESENKVVILDSFDPLRAEEDEREVSVPAEILRKSRKFPPALPVWARPDYNPPLLEPWKDPDYVPPVVHGCPLPPVKAPPIPPPRRKRTVVLTESTVSSALAELATKTFGSSESSAAGSGTATAPPDQPSDDGDAGSDVESCSSMPPLEGEPGDPDLSDGSWSTVSEEDGEGVICCSMSYTWTGALITPCAAEESKLPINALSNSLLRHHNMVYATTSRSASQRQKKVTIDRLQVLDDHYRDVLKEMKAKASTVKAKLLSVEEACKLTPPHSARSKFGYGAKDVRNLSGKAINHIRSVWKDLLEDTETPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSTLPQAVMGSSYGFQYSPGQRVEFLVNAWKSKKCPMGFSYDTRCFDSTVTESDIRVEESIYQCCDLAPEARQAIRSLTERLYIGGPLTNSKGQNCGYRRCRASGVLTTSCGNTLTCYLKASAACRAAKLQDCTMLVCGDDLVVICESAGTQEDAASLRVFTEAMTRYSAPPGDLPQPEYDQELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWATARHTPVNSWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQIYGACYSIEPLDLPQIIERLHGLSAFSLHSYSPGEINRVASCLRKLGVPPLRAWRHRARSVRAKLLSQGGRAATCGRYLFNWAVKTKLKLTPIPAASQLDLSKWFVAGYGGGDIYHSLSRARPRWFMLCLLLLSVGVGIYLLPNR AAD267D55CDFE215 o43889-2 Cyclic AMP-responsive element-binding protein 3 CREB3 LZIP Luman Transcription factor LZIP-alpha LZIP Leucine zipper protein protein protein human Homo sapiens Human MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG 82152E496B924EEC hcv-lzip-1 2 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association hcv-lzip-3 4 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association hcv-lzip-4 1 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey gal 4 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association hcv-lzip-5 1 6 unspecified role unspecified role bait bait gal 4 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association hcv-lzip-6 5 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey gal 4 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association hcv-lzip-7 5 6 unspecified role unspecified role bait bait gal 4 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association hcv-lzip-8 3 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction lzip-lzip-1 4 7 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association lzip-hcv-1 4 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association