IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The winged-helix/forkhead protein myocyte nuclear factor beta (MNF-beta) forms a co-repressor complex with mammalian sin3B. The winged-helix/forkhead protein myocyte nuclear factor beta (MNF-beta) forms a co-repressor complex with mammalian sin3B. Biochem. J. (0264-6021) 2000 imex curation Yang Q., Kong Y., Rothermel B., Garry DJ., Bassel-Duby R., Williams RS. Cancer - Interactions investigated in the context of cancer An adult mouse cardiac cDNA library was screened williams@ryburn.swmed.edu Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Yang Q., Kong Y., Rothermel B., Garry DJ., Bassel-Duby R., Williams RS. Cancer - Interactions investigated in the context of cancer An adult mouse cardiac cDNA library was screened williams@ryburn.swmed.edu Accepted 2006-MAR-16 by JYOTI. Biochem. J. (0264-6021) 2000 Only protein-protein interactions imex curation The winged-helix/forkhead protein myocyte nuclear factor beta (MNF-beta) forms a co-repressor complex with mammalian sin3B. The winged-helix/forkhead protein myocyte nuclear factor beta (MNF-beta) forms a co-repressor complex with mammalian sin3B. Biochem. J. (0264-6021) 2000 imex curation Yang Q., Kong Y., Rothermel B., Garry DJ., Bassel-Duby R., Williams RS. Cancer - Interactions investigated in the context of cancer An adult mouse cardiac cDNA library was screened williams@ryburn.swmed.edu Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang Q., Kong Y., Rothermel B., Garry DJ., Bassel-Duby R., Williams RS. Cancer - Interactions investigated in the context of cancer An adult mouse cardiac cDNA library was screened 1 williams@ryburn.swmed.edu Accepted 2006-MAR-16 by JYOTI. Biochem. J. (0264-6021) 2000 Only protein-protein interactions imex curation The winged-helix/forkhead protein myocyte nuclear factor beta (MNF-beta) forms a co-repressor complex with mammalian sin3B. The winged-helix/forkhead protein myocyte nuclear factor beta (MNF-beta) forms a co-repressor complex with mammalian sin3B. Biochem. J. (0264-6021) 2000 imex curation Yang Q., Kong Y., Rothermel B., Garry DJ., Bassel-Duby R., Williams RS. Cancer - Interactions investigated in the context of cancer An adult mouse cardiac cDNA library was screened williams@ryburn.swmed.edu Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Yang Q., Kong Y., Rothermel B., Garry DJ., Bassel-Duby R., Williams RS. Cancer - Interactions investigated in the context of cancer An adult mouse cardiac cDNA library was screened 3C williams@ryburn.swmed.edu Accepted 2006-MAR-16 by JYOTI. Biochem. J. (0264-6021) 2000 Only protein-protein interactions imex curation The winged-helix/forkhead protein myocyte nuclear factor beta (MNF-beta) forms a co-repressor complex with mammalian sin3B. The winged-helix/forkhead protein myocyte nuclear factor beta (MNF-beta) forms a co-repressor complex with mammalian sin3B. Biochem. J. (0264-6021) 2000 imex curation Yang Q., Kong Y., Rothermel B., Garry DJ., Bassel-Duby R., Williams RS. Cancer - Interactions investigated in the context of cancer An adult mouse cardiac cDNA library was screened williams@ryburn.swmed.edu Only protein-protein interactions mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Q., Kong Y., Rothermel B., Garry DJ., Bassel-Duby R., Williams RS. Cancer - Interactions investigated in the context of cancer An adult mouse cardiac cDNA library was screened 1B williams@ryburn.swmed.edu Accepted 2006-MAR-16 by JYOTI. Biochem. J. (0264-6021) 2000 Only protein-protein interactions imex curation q62141-2 Paired amphipathic helix protein Sin3b Sin3b Kiaa0700 Histone deacetylase complex subunit Sin3b Transcriptional corepressor Sin3b protein protein mouse Mus musculus Mouse MAHAGSGGSAGRGFGGSRWGRSGSGGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPVSAPAKVGLQLKCAVVWFGYCTAEE 11A75E8F67C818AE foxk1_mouse Forkhead box protein K1 Myocyte nuclear factor Foxk1 Mnf protein protein mouse Mus musculus Mouse MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPATTSPPPPAQPPPGPPALPAEPGPGPVPSTVATATTTAPALVAAAAASVRQSPGPALARLEGREFEFLMRQPSVTIGRNSSQGSVDLSMGLSSFISRRHLQLSFQEPHFYLRCLGKNGVFVDGAFQRRGAPALQLPQQCTFRFPSTAIKIQFTSLYHKEEAPASPLRPLYPQISPLKIHIPEPDLRSLVSPIPSPTGTISVPNSCPASPRGAGSSSYRFVQNVTSDLQLAAEFAAKAASEQQADASGGDSPKDESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSSGLQTPECLSREGSPIPHDPDLGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSNLVAKPVAYMPASIVTSQQPSGHAIHVVQQAPTVTMVRVVTTSANSANGYILASQGSTGTSHDTAGTAVLDLGNEARGLEEKPTIAFATIPAASRVIQTVASQMAPGVPGHTVTILQPATPVTIGQHHLPVRAVTQNGKHAVPTNSLTGNAYALSSPLQLLAAQASSSTPVVITRVCEVGPEEPAAAVSVAANAAPTPAASTTTSASSSGEPEVKRSRVEEPGGTATTQPTAMAATGPQGPGTGE 0A0D3049B7846328 dna dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid in vitro In vitro GTACTGTAAATAAATAGTGCCGCGGTACCAGATC 52414017E396561B mnfb-sin3b-1 1 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey physical association physical association mnfa-sin3b-1 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association mnfb-sin3b-2 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association mnfa-sin3b-2 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association sin3b-mnfb-1 2 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association sin3b-mnfa-1 2 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association mnfa-sin3b-3 4 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey n terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association mnfb-sin3b-3 4 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey n terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association mnfa-dna-1 3 7 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role neutral component neutral component in vitro In vitro direct interaction direct interaction mnfb-dna-1 3 7 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role neutral component neutral component in vitro In vitro direct interaction direct interaction