IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Evidence for interaction between human PRUNE and nm23-H1 NDPKinase. Evidence for interaction between human PRUNE and nm23-H1 NDPKinase. Oncogene (0950-9232) 1999 imex curation Reymond A., Volorio S., Merla G., Al-Maghtheh M., Zuffardi O., Bulfone A., Ballabio A., Zollo M. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Cancer - Interactions investigated in the context of cancer Method is described as an improved 2-hybrid procedure based on PMID: 11790255. Mating of two haploid yeast strains of opposite mating type, each harboring one of the respective plasmids, results in the formation of doubly transformed diploid zygotes. no email jyoti Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Reymond A., Volorio S., Merla G., Al-Maghtheh M., Zuffardi O., Bulfone A., Ballabio A., Zollo M. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Method is described as an improved 2-hybrid procedure based on PMID: 11790255. Mating of two haploid yeast strains of opposite mating type, each harboring one of the respective plasmids, results in the formation of doubly transformed diploid zygotes. no email Accepted 2008-Not a month!-29 by JYOTI. Oncogene (0950-9232) 1999 jyoti Only protein-protein interactions imex curation Evidence for interaction between human PRUNE and nm23-H1 NDPKinase. Evidence for interaction between human PRUNE and nm23-H1 NDPKinase. Oncogene (0950-9232) 1999 imex curation Reymond A., Volorio S., Merla G., Al-Maghtheh M., Zuffardi O., Bulfone A., Ballabio A., Zollo M. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Cancer - Interactions investigated in the context of cancer Method is described as an improved 2-hybrid procedure based on PMID: 11790255. Mating of two haploid yeast strains of opposite mating type, each harboring one of the respective plasmids, results in the formation of doubly transformed diploid zygotes. no email jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Reymond A., Volorio S., Merla G., Al-Maghtheh M., Zuffardi O., Bulfone A., Ballabio A., Zollo M. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. Method is described as an improved 2-hybrid procedure based on PMID: 11790255. Mating of two haploid yeast strains of opposite mating type, each harboring one of the respective plasmids, results in the formation of doubly transformed diploid zygotes. no email Accepted 2008-Not a month!-29 by JYOTI. Oncogene (0950-9232) 1999 jyoti Only protein-protein interactions imex curation ndka_human Nucleoside diphosphate kinase A Tumor metastatic process-associated protein Metastasis inhibition factor nm23 Granzyme A-activated DNase NME1 NDPKA NM23 NM23-H1 protein protein human Homo sapiens Human MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE AAE9C0DF63CB70A1 prun1_human Exopolyphosphatase PRUNE1 PRUNE1 Drosophila-related expressed sequence 17 HTcD37 PRUNE Protein prune homolog 1 protein protein human Homo sapiens Human MEDYLQGCRAALQESRPLHVVLGNEACDLDSTVSALALAFYLAKTTEAEEVFVPVLNIKRSELPLRGDIVFFLQKVHIPESILIFRDEIDLHALYQAGQLTLILVDHHILSKSDTALEEAVAEVLDHRPIEPKHCPPCHVSVELVGSCATLVTERILQGAPEILDRQTAALLHGTIILDCVNMDLKIGKATPKDSKYVEKLEALFPDLPKRNDIFDSLQKAKFDVSGLTTEQMLRKDQKTIYRQGVKVAISAIYMDLEAFLQRSNLLADLHAFCQAHSYDVLVAMTIFFNTHNEPVRQLAIFCPHVALQTTICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK 34BE1909AB89DBD5 prune-nme1 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association We tested the ability of human PRUNE protein to interact with human nm23-H1 in interaction-mating experiments Fig. 4A Co-expression appeared to be deleterious to yeast cell growth. nme1-nme1-1 2 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P15531:p.Pro96Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P S Wed May 02 18:02:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro96ser' Tue Jun 30 17:54:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro96Ser' P15531:p.Ser120Gly mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S G Wed May 02 18:41:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser120gly' Tue Jun 30 18:12:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser120Gly' 3 unspecified role unspecified role bait bait P15531:p.Pro96Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P S Wed May 02 14:48:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro96ser' Tue Jun 30 17:02:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro96Ser' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P15531:p.Ser120Gly mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S G Wed May 02 19:25:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser120gly' Tue Jun 30 19:58:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser120Gly' 10 15 physical association physical association We tested the ability of human PRUNE protein to interact with human nm23-H1 in interaction-mating experiments Fig. 4A prune-nme1-1 1 4 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association To provide independent evidence of the PRUNE/ nm23-H1 interaction, in vitro translated and labelled HA tagged-PRUNE and FLAG tagged-nm23-H1 were mixed and a low stringency co-immunoprecipi-tation was performed using anti-HA or anti-FLAG antibody and proteinA-Sepharose. Fig. 4C