IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Functional connection between p53 and caspase-2 is essential for apoptosis induced by DNA damage. Functional connection between p53 and caspase-2 is essential for apoptosis induced by DNA damage. Oncogene (0950-9232) 2006 imex curation Vakifahmetoglu H., Olsson M., Orrenius S., Zhivotovsky B. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology Untreated or 5-FU-treated p53+/+ and p53-/- HCT116 cells were harvested at 24 h and used in this assay. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Vakifahmetoglu H., Olsson M., Orrenius S., Zhivotovsky B. Apoptosis - Interactions involving proteins with a function related to apoptosis Untreated or 5-FU-treated p53+/+ and p53-/- HCT116 cells were harvested at 24 h and used in this assay. Accepted 2006-AUG-29 by JYOTI. Oncogene (0950-9232) 2006 Only protein-protein interactions imex curation Functional connection between p53 and caspase-2 is essential for apoptosis induced by DNA damage. Functional connection between p53 and caspase-2 is essential for apoptosis induced by DNA damage. Oncogene (0950-9232) 2006 imex curation Vakifahmetoglu H., Olsson M., Orrenius S., Zhivotovsky B. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology Untreated or 5-FU-treated p53+/+ and p53-/- HCT116 cells were harvested at 24 h and used in this assay. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Vakifahmetoglu H., Olsson M., Orrenius S., Zhivotovsky B. Apoptosis - Interactions involving proteins with a function related to apoptosis Untreated or 5-FU-treated p53+/+ and p53-/- HCT116 cells were harvested at 24 h and used in this assay. Accepted 2006-AUG-29 by JYOTI. Oncogene (0950-9232) 2006 Only protein-protein interactions imex curation pidd1_human p53-induced death domain-containing protein 1 PIDD1 LRDD Leucine-rich repeat and death domain-containing protein PIDD protein protein human Homo sapiens Human MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAGLSGLAHLAHLDLSFNSLETLPACVLQMRGLGALLLSHNCLSELPEALGALPALTFLTVTHNRLQTLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLASNRLQSLPASLAGLRSLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPPELLDAPFVRLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLACGVRLQFPAGATATPITIRYRLLLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVVRTRNDNSWGDLETYLEEEAPQRLWAHCQVPHFSWFLVVSRPVSNACLVPPEGTLLCSSGHPGVKVIFPPGATEEPRRVSMQVVRMAGRELQALLGEPEAAVSPLLCLSQSGPPSFLQPVTVQLPLPSGITGLSLDRSRLHLLYWAPPAATWDDITAQVVLELTHLYARFQVTHFSWYWLWYTTKNCVGGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFERGIDVDADRPDCVEGRICFVFYSHLKNVKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLAPKDPALPGSSAPQPPEPAQA 8C98FC64230B57F8 cradd_human Death domain-containing protein CRADD Caspase and RIP adapter with death domain RIP-associated protein with a death domain CRADD RAIDD protein protein human Homo sapiens Human MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE 3437CC612C85E402 casp2_human Caspase-2 Protease ICH-1 Neural precursor cell expressed developmentally down-regulated protein 2 CASP2 ICH1 NEDD2 protein protein human Homo sapiens Human MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT 6EF0ED05EF808385 casp2-raidd-pidd 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait association association Figure 5a Interaction of caspase-2, RAIDD and PIDD. casp2-raidd-pidd-1 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association Figure 5b Interaction of caspase-2, RAIDD and PIDD. casp2-raidd-pidd-2 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Figure 5c Interaction of caspase-2, RAIDD and PIDD. casp2-pidd-3 1 5 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component colocalization colocalization Figure 6a and 6b Colocalisation of PIDD, RAIDD and caspase-2 in HCT116p53 and p53 cells. raidd-pidd-4 1 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component colocalization colocalization Figure 6c and 6d Colocalisation of PIDD, RAIDD and caspase-2 in HCT116p53 and p53 cells.