UniProt UniProt http://www.uniprot.org Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Nature (0028-0836) 2006 imex curation Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp Accepted 2006-AUG-25 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. Nature (0028-0836) 2006 Only protein-protein interactions imex curation Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Nature (0028-0836) 2006 imex curation Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. HEK 293T cells heve been transfected with FLAG-tagged SGOL1. ywatanab@iam.u-tokyo.ac.jp Accepted 2006-SEP-15 by ORCHARD. Nature (0028-0836) 2006 Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Nature (0028-0836) 2006 imex curation Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp Accepted 2006-AUG-25 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. Nature (0028-0836) 2006 Only protein-protein interactions imex curation Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Nature (0028-0836) 2006 imex curation Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp Accepted 2006-AUG-25 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. Nature (0028-0836) 2006 Only protein-protein interactions imex curation Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Nature (0028-0836) 2006 imex curation Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast protein three hybrid protein three hybrid trihybrid bridge assay protein 3-hybrid protein tri hybrid trihybrid bridge assay predetermined predetermined participant predetermined Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp Accepted 2006-AUG-25 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. Nature (0028-0836) 2006 Only protein-protein interactions imex curation Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Nature (0028-0836) 2006 imex curation Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp Accepted 2006-AUG-25 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. Nature (0028-0836) 2006 Only protein-protein interactions imex curation Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Nature (0028-0836) 2006 imex curation Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kitajima TS., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima SA., Watanabe Y. BioCreative - Critical Assessment of Information Extraction systems in Biology fig 1a shows list of CoIPed proteins with by anti-FLAG-SGOL1 in 293T cells. List summarizes 2 independent experiments without further details. Not annotated. ywatanab@iam.u-tokyo.ac.jp Accepted 2006-AUG-25 by ORCHARD. Nature (0028-0836) 2006 Only protein-protein interactions imex curation sgo1_schpo Shugoshin-1 sgo1 SPBP35G2.03c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNFQFINSNINNEDKLPMESLKKKFLKQNREIIKINTQLSIKIRESENEIQDLIQENFTLKSYLVKLEARFRNQSQTEDLLKNFFPEIQTIHKKISQVQSLLKIIEKKCSSDFLEANVKSQFTTCENKDSKEDYQILHNKRLEYVSFNDELKSLETGQPLYCFQDFQKKVHGPPALSEKPGKCILKDKTNAHVNKIPQDEVNYSLPQKNITIFSKELKENEFESINEGETEEEKAKTSNVCVCIPCKSAEQITDLKGQATGDSSPCDFEESQPRINGREKLRRSVKVINYAIPSLRTKLRRDFDLPSDRKRKRHPRGKA 32F52DD0A1E0542A 32F52DD0A1E0542A 2ad1_schpo Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta 1 isoform PP2A, B subunit, B' delta 1 isoform par1 pbp1 SPCC188.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MKGIKSKMLSRGKSQDTQKSSKKKESKKSNSHDSSKAPKESPSTDPNGSVIGAQNDFLTVPKHSGKKVPIDTTPTPRDEILLENVRTVRKQRSSLYHISENRNLVRLPSFTDVPVNKWHSLALEKLEQCCVVFDFNDPSTDLYGKEVKREALQDLIDLISVRKEAIDESLYPSIVHMFAVNVFRPLPPPSNPPGEIMDLEEDEPALEVAWPHLHLVYDFFLRFFESPSLNTSVAKVYINQKFIRKLLVLFDSEDPRERDFLKTTLHRIYGKFLSLRAFIRRSINNLFLQFVYENEQFNGIAELLEILGSIINGFALPLKEEHKIFLSRVLIPLHKAKSLPLYYPQIAYGIVQFVEKDSSVTEEVVLGLLRYWPKVNSSKEVLFLNEIEDIIEVMEPSEFLKIQVPLFHKLATSISSQNFQVAERALYFFNNDYFVHLVEENVDIILPIIYPALFEISKSHWNRVIHSMVCNVLKLFMDINPSLFDEVDAEYSESRRKKEDEEIIREERWTILENIAKENAMKLKSQNPTTVHSTTERLKKLSLDYTNG A15FD882D516F88A A15FD882D516F88A 2aab_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform PPP2R1B PP2A subunit A isoform PR65-beta PP2A subunit A isoform R1-beta protein protein human Homo sapiens Human MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLALA DIP protein P30154 original sequence version: 145 86AB20D7505210B0 sgo1_human Shugoshin 1 SGO1 SGOL1 Serologically defined breast cancer antigen NY-BR-85 Shugoshin-like 1 protein protein human Homo sapiens Human MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKSTDNVLPRTVSVRSSLKKHCNSICQFDSLDDFETSHLAGKSFEFERVGFLDPLVNMHIPENVQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANRRKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQKVSNDSNREENNESEVSLCESSGSGDDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGSKPTKTPTTTPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR DIP protein Q5FBB7 original sequence version: 89 DIP protein Q5FBB7 original sequence version: 64 DIP protein Q5FBB7 original sequence version: 92 DIP protein Q5FBB7 original sequence version: 98 90CEE0FD2B40CD9C pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P67775 original sequence version: 112 DIP protein P67775-1 original sequence version: 98 DIP protein P67775 original sequence version: 29 DIP protein P67775 original sequence version: 102 DIP protein P67775 original sequence version: 65 DIP protein P67775 original sequence version: 67 DIP protein P67775-1 original sequence version: 114 DIP protein P67775 original sequence version: 113 DIP protein P67775-1 original sequence version: 122 C602291F78F34555 2a5a_human Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform PP2A B subunit isoform B'-alpha PP2A B subunit isoform B56-alpha PP2A B subunit isoform PR61-alpha PP2A B subunit isoform R5-alpha PPP2R5A protein protein human Homo sapiens Human MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLKDATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIAKRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFLEKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLKTLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSILSNTSAE D31407F7032A6D44 sgo2_human Shugoshin 2 SGO2 Shugoshin-2 Shugoshin-like 2 Tripin SGOL2 protein protein human Homo sapiens Human MECPVMETGSLFTSGIKRHLKDKRISKTTKLNVSLASKIKTKILNNSSIFKISLKHNNRALAQALSREKENSRRITTEKMLLQKEVEKLNFENTFLRLKLNNLNKKLIDIEALMNNNLITAIEMSSLSEFHQSSFLLSASKKKRISKQCKLMRLPFARVPLTSNDDEDEDKEKMQCDNNIKSKTLPDIPSSGSTTQPLSTQDNSEVLFLKENNQNVYGLDDSEHISSIVDVPPRESHSHSDQSSKTSLMSEMRNAQSIGRRWEKPSPSNVTERKKRGSSWESNNLSADTPCATVLDKQHISSPELNCNNEINGHTNETNTEMQRNKQDLPGLSSESAREPNAECMNQIEDNDDFQLQKTVYDADMDLTASEVSKIVTVSTGIKKKSNKKTNEHGMKTFRKVKDSSSEKKRERSKRQFKNSSDVDIGEKIENRTERSDVLDGKRGAEDPGFIFNNEQLAQMNEQLAQVNELKKMTLQTGFEQGDRENVLCNKKEKRITNEQEETYSLSQSSGKFHQESKFDKGQNSLTCNKSKASRQTFVIHKLEKDNLLPNQKDKVTIYENLDVTNEFHTANLSTKDNGNLCDYGTHNILDLKKYVTDIQPSEQNESNINKLRKKVNRKTEIISGMNHMYEDNDKDVVHGLKKGNFFFKTQEDKEPISENIEVSKELQIPALSTRDNENQCDYRTQNVLGLQKQITNMYPVQQNESKVNKKLRQKVNRKTEIISEVNHLDNDKSIEYTVKSHSLFLTQKDKEIIPGNLEDPSEFETPALSTKDSGNLYDSEIQNVLGVKHGHDMQPACQNDSKIGKKPRLNVCQKSEIIPETNQIYENDNKGVHDLEKDNFFSLTPKDKETISENLQVTNEFQTVDLLIKDNGNLCDYDTQNILELKKYVTDRKSAEQNESKINKLRNKVNWKTEIISEMNQIYEDNDKDAHVQESYTKDLDFKVNKSKQKLECQDIINKHYMEVNSNEKESCDQILDSYKVVKKRKKESSCKAKNILTKAKNKLASQLTESSQTSISLESDLKHITSEADSDPGNPVELCKTQKQSTTTLNKKDLPFVEEIKEGECQVKKVNKMTSKSKKRKTSIDPSPESHEVMERILDSVQGKSTVSEQADKENNLENEKMVKNKPDFYTKAFRSLSEIHSPNIQDSSFDSVREGLVPLSVSSGKNVIIKENFALECSPAFQVSDDEHEKMNKMKFKVNRRTQKSGIGDRPLQDLSNTSFVSNNTAESENKSEDLSSERTSRRRRCTPFYFKEPSLRDKMRR DIP protein Q562F6 original sequence version: 66 6A678CB3E6DF72D7 ppm1a_human Protein phosphatase 1A Protein phosphatase 2C isoform alpha PPM1A PPPM1A Protein phosphatase IA protein protein human Homo sapiens Human MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW D48EF508B4A76687 2a5d_human Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform PPP2R5D PP2A B subunit isoform B'-delta PP2A B subunit isoform B56-delta PP2A B subunit isoform PR61-delta PP2A B subunit isoform R5-delta protein protein human Homo sapiens Human MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL DIP protein Q14738 original sequence version: 92 F15F71AF4E565387 2a5e_human Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform PPP2R5E PP2A B subunit isoform B'-epsilon PP2A B subunit isoform B56-epsilon PP2A B subunit isoform PR61-epsilon PP2A B subunit isoform R5-epsilon protein protein human Homo sapiens Human MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKFVLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLTEPVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVAERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNSTMFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT DD9CE11433F499CF set_human Protein SET Phosphatase 2A inhibitor I2PP2A Template-activating factor I HLA-DR-associated protein II PHAPII Inhibitor of granzyme A-activated DNase SET protein protein human Homo sapiens Human MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD F4664118171EF230 sgol1-ppp2ca-1 7 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 1b Here we find a specific subtype of serine/threonine protein phosphatase 2A (PP2A) associating with human shugoshin. sgol1-ppm1a-1 7 15 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 1b Here we find a specific subtype of serine/threonine protein phosphatase 2A (PP2A) associating with human shugoshin. sgol1-ppp2r5a-1 7 11 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 1b Here we find a specific subtype of serine/threonine protein phosphatase 2A (PP2A) associating with human shugoshin. sgol1-ppp2r5a-2 4 11 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization 1c Colocalization has been observed at centromeres from mitotic prophase to metaphase. Here we find a specific subtype of serine/threonine protein phosphatase 2A (PP2A) associating with human shugoshin. sgol2-ppp2ca-1 7 14 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Supplement Fig 6. Here we find a specific subtype of serine/threonine protein phosphatase 2A (PP2A) associating with human shugoshin. sgol2-ppm1a-1 7 15 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association Supplement Fig. 6 Here we find a specific subtype of serine/threonine protein phosphatase 2A (PP2A) associating with human shugoshin. ppp2r5d-ppp2r5a-1 3 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Supplement Fig. 1 Here we find a specific subtype of serine/threonine protein phosphatase 2A (PP2A) associating with human shugoshin. ppp2r5d-sgol1-1 3 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Supplement Fig. 1 Here we find a specific subtype of serine/threonine protein phosphatase 2A (PP2A) associating with human shugoshin. ppp2r5a-sgol2-2 3 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Supplement Fig. 1 ppp2r5a-sgol1-1 5 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role ancillary ancillary yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Supplement Fig. 1 b par1-sgo1-1 1 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5a Meiotic shugoshin of fission yeast also associates with PP2A, with both proteins collaboratively protecting Rec8-containing cohesin at centromeres. par1-sgo1-2 6 9 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 5b Colocalization observed at centromeres during meiosis I. Meiotic shugoshin of fission yeast also associates with PP2A, with both proteins collaboratively protecting Rec8-containing cohesin at centromeres. sgol1-pp2r1b-ppp2r5a 2 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey association association 1A