IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Asf1 is required for viability and chromatin assembly during DNA replication in vertebrate cells. Asf1 is required for viability and chromatin assembly during DNA replication in vertebrate cells. J. Biol. Chem. (0021-9258) 2006 imex curation Sanematsu F., Takami Y., Barman HK., Fukagawa T., Ono T., Shibahara K., Nakayama T. BioCreative - Critical Assessment of Information Extraction systems in Biology Chromatin - Epigenetic interactions resulting in chromatin modulation tnakayam@med.miyazaki-u.ac.jp 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sanematsu F., Takami Y., Barman HK., Fukagawa T., Ono T., Shibahara K., Nakayama T. BioCreative - Critical Assessment of Information Extraction systems in Biology tnakayam@med.miyazaki-u.ac.jp Accepted 2006-SEP-14 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Asf1 is required for viability and chromatin assembly during DNA replication in vertebrate cells. Asf1 is required for viability and chromatin assembly during DNA replication in vertebrate cells. J. Biol. Chem. (0021-9258) 2006 imex curation Sanematsu F., Takami Y., Barman HK., Fukagawa T., Ono T., Shibahara K., Nakayama T. BioCreative - Critical Assessment of Information Extraction systems in Biology Chromatin - Epigenetic interactions resulting in chromatin modulation tnakayam@med.miyazaki-u.ac.jp 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions chick-dt40 Gallus gallus bursa lymphoma dt40 chicken bursa lymphoma http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm chicken bursa lymphoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sanematsu F., Takami Y., Barman HK., Fukagawa T., Ono T., Shibahara K., Nakayama T. BioCreative - Critical Assessment of Information Extraction systems in Biology tnakayam@med.miyazaki-u.ac.jp Accepted 2006-SEP-14 by DAVET. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Asf1 is required for viability and chromatin assembly during DNA replication in vertebrate cells. Asf1 is required for viability and chromatin assembly during DNA replication in vertebrate cells. J. Biol. Chem. (0021-9258) 2006 imex curation Sanematsu F., Takami Y., Barman HK., Fukagawa T., Ono T., Shibahara K., Nakayama T. BioCreative - Critical Assessment of Information Extraction systems in Biology Chromatin - Epigenetic interactions resulting in chromatin modulation tnakayam@med.miyazaki-u.ac.jp 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sanematsu F., Takami Y., Barman HK., Fukagawa T., Ono T., Shibahara K., Nakayama T. BioCreative - Critical Assessment of Information Extraction systems in Biology tnakayam@med.miyazaki-u.ac.jp Accepted 2006-SEP-14 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation caf1b_chick Chromatin assembly factor 1 subunit B CHAF1B CAF1P60 Chromatin assembly factor I p60 subunit RCJMB04_5h12 protein protein chick Gallus gallus (Chicken) Chicken MKVITCEIAWHNKEPVYSLDFQHGTDGKINRLASAGVDTAVRVWKVEKGPDGKAIVEFLSNLARHTKAVNVVRFSPSGEVLASGGDDAVILLWKLNDSKELEPLAFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWTSDGNYMASASVDNTAIMWDVVKGQKVSILNEHKSYVQGITWDPLGQYIATLSCDRVLRVYNTQTKRVAFNVTKMPSESGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVTNTTYVFSRNNLKRPMGHLPCPGKATLAVRCCPVYFELRQALNKGEVSQKSSPALLNLPYRLVFAVASEDSVLFYDTEQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDELGIPLKEKPQIHVRTSVVTEKKVKKSQPNKVISPGSRLTEGTSLSTPTLQPKTPVAAAKDLPSTPVGIKNVPVSSSEERKISQPASQSTKVNQPRRITLNTLQAWSKTPRRVNLIPLKPDTPASVYTDTVPVPPSSEQEHERPLPSGDSLQNPPASKRPRTEEMPLSVSAEDQIGCKPNK 53A17D98B3A828A8 h4_chick Histone H4 H4-I H4-II H4-III H4-IV H4-V H4-VI H4-VII protein protein chick Gallus gallus (Chicken) Chicken MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG A9E5DFD3F8B97598 hira_chick Protein HIRA TUP1-like enhancer of split protein 1 HIRA TUPLE1 protein protein chick Gallus gallus (Chicken) Chicken MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMAPVLKEEDEKNENIPKMLCQMDNHLACVNCVRWSNNGVYLASGGDDKLIMVWKRAAYIGPSTVFGSSSKLTNVEQWRCVSILRSHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLKGHSGLVKGLTWDPVGKYIASQADDRSLKVWRTMDWQLETSITKPFDECGGTTHVLRLSWSPDGHYLVSAHAMNNSGPTAQIIERDGWKTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSTKSSCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQDELGDPLSEEEKSNIHQSTYGKSLAIMTEAQLSTTIIENPEMLKYQQRQQQQQAEQKNASIREASGAATTAPKVASMVNGESLEDIRKNLLKKQVETRTADGRRRITPLCIAQLDTGDFSTAFFNSIPISGTLAGSIMSSQNNQQLMSLDSNAANSLNTSKPSAEPTAASIKPTDDAASKDGVNATSVSTAPPASSSSVLTTPSKIEPMKAFDSRFTERSKATSGTAVVTNTNQTVVDRLKDQNLIKDNKPKDILESSSDSEEKIPAAKPLSAPKRKLELEGETVEKKKKGRPRKDSRLVPVTLTVQSPAALASEKDAACISAPALALKLPTPIPQKSFTLQVSSDPSMYLEVENEMTTVGGSKLSRLKCNREGKEWETVLTSRILTAAGSCEIVCVACEKRMLSVFSACGRRLLPPIILNTPISTLHCTGSYIMTLTTAATLSVWDVHKQTVIVRDESLQTILSGSDTTVSQILLTQHGIPVMSMSDGKAYCFNPSLSTWNLVSDKQDSLAQCADFRSSLPSQEAMLCSGPLAVIQGRTSNSGRQAARLFSMPHLVQQETTLAYLENQIAAALMLQSSHEYRHWLLIYARYLVNEGFEYRLRELCKDLLGPVHYSRGSQWESTVMGLRKRELLKELLPVIGQNLFQRLFTEYQEQLDIL 24DCECAFA52E9F60 asf1_chick Histone chaperone ASF1 Anti-silencing function protein 1 homolog ASF1 protein protein chick Gallus gallus (Chicken) Chicken MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESHMDCM 9819D531D3A9FC68 h32_chick Histone H3.2 H3-I H3-II H3-III H3-IV H3-V H3-VI H3-VII H3-VIII Histone H3 class I protein protein chick Gallus gallus (Chicken) Chicken MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 6FD8508EA50A0EEC asf1-hira 2 7 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey lys12 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association 5 Deletion mutational analyses revealed that the minimum binding domain of Asf1 for p60, histones H3/H4, and HIRA was confined to 1-155 aa, which lacks a Ser- and Thr-rich region of the C-terminal tail. The conditional knockout Asf1 in chick was HA tagged and the cells were allowed to recover for 24hrs to eliminate the effects of internal Asf1. asf1-hira-1 1 7 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Deletion mutational analyses revealed that the minimum binding domain of Asf1 for p60, histones H3/H4, and HIRA was confined to 1-155 aa, which lacks a Ser- and Thr-rich region of the C-terminal tail. This N-terminal domain, containing 10 beta-sheets, has been well defined to be structurally conserved 5C, 5D asf1-caf 3 7 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q3C1E9:p.Glu36_Asp37delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain ED AA Thu Jul 07 12:17:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was glu36ala asp37ala Fri Jul 22 11:11:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu36ala,asp37ala' Wed May 02 18:45:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_asp36-37ala_ala' Tue Jun 30 19:44:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu36_Asp37delinsAlaAla' 4 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5E mutant protein Asf also abolished binding ability as to p60 but retained binding ability to histones H3/H4 (Fig. 5B). These findings were also confirmed in COS-7 cells, in which those were transiently expressed