IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Assembly, activation, and trafficking of the Fet3p.Ftr1p high affinity iron permease complex in Saccharomyces cerevisiae. Assembly, activation, and trafficking of the Fet3p.Ftr1p high affinity iron permease complex in Saccharomyces cerevisiae. J. Biol. Chem. (0021-9258) 2006 imex curation Singh A., Severance S., Kaur N., Wiltsie W., Kosman DJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Interaction is detected by quantification of the Beta-galactosidase activity. Beta-galactosidase activity ranging from 1 to 8. fig 3 camkos@buffalo.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Singh A., Severance S., Kaur N., Wiltsie W., Kosman DJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Interaction is detected by quantification of the Beta-galactosidase activity. Beta-galactosidase activity ranging from 1 to 8. fig 3 camkos@buffalo.edu Accepted 2006-JUN-15 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Assembly, activation, and trafficking of the Fet3p.Ftr1p high affinity iron permease complex in Saccharomyces cerevisiae. Assembly, activation, and trafficking of the Fet3p.Ftr1p high affinity iron permease complex in Saccharomyces cerevisiae. J. Biol. Chem. (0021-9258) 2006 imex curation Singh A., Severance S., Kaur N., Wiltsie W., Kosman DJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Interaction is detected by quantification of the Beta-galactosidase activity. Beta-galactosidase activity ranging from 1 to 8. fig 3 camkos@buffalo.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Singh A., Severance S., Kaur N., Wiltsie W., Kosman DJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Interaction is detected by quantification of the Beta-galactosidase activity. Beta-galactosidase activity ranging from 1 to 8. fig 3 camkos@buffalo.edu Accepted 2006-JUN-15 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Assembly, activation, and trafficking of the Fet3p.Ftr1p high affinity iron permease complex in Saccharomyces cerevisiae. Assembly, activation, and trafficking of the Fet3p.Ftr1p high affinity iron permease complex in Saccharomyces cerevisiae. J. Biol. Chem. (0021-9258) 2006 imex curation Singh A., Severance S., Kaur N., Wiltsie W., Kosman DJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Interaction is detected by quantification of the Beta-galactosidase activity. Beta-galactosidase activity ranging from 1 to 8. fig 3 camkos@buffalo.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Singh A., Severance S., Kaur N., Wiltsie W., Kosman DJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Interaction is detected by quantification of the Beta-galactosidase activity. Beta-galactosidase activity ranging from 1 to 8. fig 3 camkos@buffalo.edu Accepted 2006-JUN-15 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Assembly, activation, and trafficking of the Fet3p.Ftr1p high affinity iron permease complex in Saccharomyces cerevisiae. Assembly, activation, and trafficking of the Fet3p.Ftr1p high affinity iron permease complex in Saccharomyces cerevisiae. J. Biol. Chem. (0021-9258) 2006 imex curation Singh A., Severance S., Kaur N., Wiltsie W., Kosman DJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Interaction is detected by quantification of the Beta-galactosidase activity. Beta-galactosidase activity ranging from 1 to 8. fig 3 camkos@buffalo.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Singh A., Severance S., Kaur N., Wiltsie W., Kosman DJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Interaction is detected by quantification of the Beta-galactosidase activity. Beta-galactosidase activity ranging from 1 to 8. fig 3 camkos@buffalo.edu Accepted 2006-JUN-15 by ORCHARD. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation fet3_yeast Iron transport multicopper oxidase FET3 YM9796.11 YMR058W FET3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTNALLSIAVLLFSMLSLAQAETHTFNWTTGWDYRNVDGLKSRPVITCNGQFPWPDITVNKGDRVQIYLTNGMNNTNTSMHFHGLFQNGTASMDGVPFLTQCPIAPGSTMLYNFTVDYNVGTYWYHSHTDGQYEDGMKGLFIIKDDSFPYDYDEELSLSLSEWYHDLVTDLTKSFMSVYNPTGAEPIPQNLIVNNTMNLTWEVQPDTTYLLRIVNVGGFVSQYFWIEDHEMTVVEIDGITTEKNVTDMLYITVAQRYTVLVHTKNDTDKNFAIMQKFDDTMLDVIPSDLQLNATSYMVYNKTAALPTQNYVDSIDNFLDDFYLQPYEKEAIYGEPDHVITVDVVMDNLKNGVNYAFFNNITYTAPKVPTLMTVLSSGDQANNSEIYGSNTHTFILEKDEIVEIVLNNQDTGTHPFHLHGHAFQTIQRDRTYDDALGEVPHSFDPDNHPAFPEYPMRRDTLYVRPQSNFVIRFKADNPGVWFFHCHIEWHLLQGLGLVLVEDPFGIQDAHSQQLSENHLEVCQSCSVATEGNAAANTLDLTDLTGENVQHAFIPTGFTKKGIIAMTFSCFAGILGIITIAIYGMMDMEDATEKVIRDLHVDPEVLLNEVDENEERQVNEDRHSTEKHQFLTKAKRFF 71CB4352B87746E6 71CB4352B87746E6 fth1_yeast Iron transporter FTH1 YBR1446 YBR207W FTH1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAFEDYFSFQIFFIFLRESLEIVVIVSILLTIVKQGLSVEDDSPFEGSSSSAGLPSPNTNTNADSTTAFLQAGPSDGNAIGTSATAANNKSRPLNVEEEEEIYEYSNELRDQDRESDEHTADNVKLYQKLKIQILAGGAFGLLLCMLIGGAFVSIFYHIGTDLWTLSEHYYEGVLSLVASVIISVMGLFFLRMGKLREKFRVKLASIIYSKDNNLLGNKTQKGVKFSEKYSFFILPFITTLREGLEAVVFIGGIGIDQPLSSIPLSMVLATAISTVFGIFFFRYSSSLSLKICLVVATCFLYLIAAGLFSKGVWQLELQDYVNKCNGQDMSEVGNGPGSYDISRSVWHVNCCNGEKDGGWMIFTAIFGWTNSATVGSVISYNAYWLVLICALKLLMIEEKYGYIPYLPISWQKKRIMKRLSIAKASLDLKHHTSELNSSTSEPDSQRRSKDSSVPLIIDSSGSAN 7B4E620ABC39A053 7B4E620ABC39A053 ftr1_yeast Plasma membrane iron permease FTR1 YER145C protein protein yeast Saccharomyces cerevisiae Baker's yeast MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQVWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMISMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLLPFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLYYGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEGGDGNGSYNIRKAVYHVNCCNPELDNGWDIFNALLGWQNTGYLSSMLCYNIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTEEQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLHVKADSL 3E155BF6195AD867 ctr1_yeast Copper transport protein CTR1 CTR1 P9642.3 YPR124W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEGMNMGSSMNMDAMSSASKTVASSMASMSMDAMSSASKTILSSMSSMSMEAMSSASKTLASTMSSMASMSMGSSSMSGMSMSMSSTPTSSASAQTTSDSSMSGMSGMSSSDNSSSSGMDMDMSMGMNYYLTPTYKNYPVLFHHLHANNSGKAFGIFLLFVVAAFVYKLLLFVSWCLEVHWFKKWDKQNKYSTLPSANSKDEGKHYDTENNFEIQGLPKLPNLLSDIFVPSLMDLFHDIIRAFLVFTSTMIIYMLMLATMSFVLTYVFAVITGLALSEVFFNRCKIAMLKRWDIQREIQKAKSCPGFGNCQCGRHPEPSPDPIAVADTTSGSDQSTRLEKNNESKVAISENNQKKTPTQEEGCNCATDSGKNQANIERDILENSKLQEQSGNMDQNLLPAEKFTHN 569C9CB19C1117E8 569C9CB19C1117E8 fet5_yeast Iron transport multicopper oxidase FET5 YFL041W FET5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLFYSFVWSVLAASVALAKTHKLNYTASWVTANPDGLHEKRMIGFNGEWPLPDIHVEKGDRVELYLTNGFQDNTATSLHFHGLFQNTSLGNQLQMDGPSMVTQCPIVPGQTYLYNFTVPEQVGTFWYHAHMGAQYGDGMRGAFIIHDPEEPFEYDHERVITLSDHYHENYKTVTKEFLSRYNPTGAEPIPQNILFNNTMNVTLDFTPGETYLFRFLNVGLFVSQYIILEDHEMSIVEVDGVYVKPNFTDSIYLSAGQRMSVLIKAKDKMPTRNYAMMQIMDETMLDVVPPELQLNQTIQMRYGHSLPEARALNIEDCDLDRATNDFYLEPLIERDLLAHYDHQIVMDVRMVNLGDGVKYAFFNNITYVTPKVPTLTTLLTSGKLASDPRIYGDNINAQLLKHNDIIEVVLNNYDSGRHPFHLHGHNFQIVQKSPGFHVDEAYDESEQDEMTVPYNESAPLQPFPERPMVRDTVVLEPSGHVVLRFRADNPGVWYFHCHVDWHLQQGLASVFIEAPVLLQEREKLNENYLDICKAADIPVVGNAAGHSNDWFDLKGLPRQPEPLPKGFTTEGYLALIISTIIGVWGLYSIAQYGIGEVIPNDEKVYHTLREILAENEIEVSRG 961757A6C86B7FAF fet3-ftr1-1 4 7 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-926273]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 637-637, sequence length 636 [EBI-926273]582-637 region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Two Fet3p Binding regions in Ftr1p were described in the article : loop 6 (231-291) and another region (317-320). Yeast two-hybrid analysis of the carboxyl-terminal ferroxidase-permease interaction. The beta-gal activity was measured as 8. fet5-fth1-1 4 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association The beta-gal activity was measured as 4 The ER signal of Fet5p was removed for Y2H. a specific interaction between Fet5p and Fth1p was localized also to the cytoplasmic, CT domains of these two proteins fet3-ftr1-2 3 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey loop 6 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Two Fet3p Binding regions in Ftr1p were described in the article : loop 6 (231-291) and another region (317-320). The ER signal of Fet3p was removed for Y2H. identification of Fet3p, Fetr1p interaction motifs. fet5-fth1-2 3 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association The ER signal of Fet5p was removed for Y2H. An in vivo interaction between Fet5p and Fth1p in the yeast vacuolar membrane has been documented by co-immunoprecipitation assay (13). This pair of proteins was used as a positive control in a yeast two-hybrid analysis fet3-ftr1-3 1 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role fluorescence donor fluorescence donor region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal cfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 34 31 proximity proximity close-contact colocalization neighbourhood interaction The FRET spectra from the combination of Fet3:CFP and Ftr1:YFP fet3-ftr1-4 1 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role fluorescence donor fluorescence donor region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal cfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 39 42 proximity proximity close-contact colocalization neighbourhood interaction The FRET spectra from the combination of Fet3:CFP and Ftr1:YFP ctr1-ctr1-1 1 8 unspecified role unspecified role fluorescence donor fluorescence donor c-terminal cfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction a FRET control by co-producing Ctr1:CFP and Ctr1:YFP in yeast fet3-ftr1-5 2 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal cfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain colocalization colocalization Fet3p�Ftr1p Interaction Motifs Are Required for Protein Trafficking to the Yeast Plasma Membrane. Fet3p�Ftr1p interaction motifs (317-320 for ftr1 and 581-584 for fet3) are required for protein trafficking to the yeast plasma membrane.