IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Parkin ubiquitinates and promotes the degradation of RanBP2. Parkin ubiquitinates and promotes the degradation of RanBP2. J. Biol. Chem. (0021-9258) 2006 imex curation Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. BioCreative - Critical Assessment of Information Extraction systems in Biology Parkinsons - Interactions investigated in the context of Parkinsons disease Synapse - Interactions of proteins with an established role in the presynapse. kchung@yonsei.ac.kr 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA Only protein-protein interactions rat-brain-cortex Rattus norvegicus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. BioCreative - Critical Assessment of Information Extraction systems in Biology Brain cortex isolated and homogenised kchung@yonsei.ac.kr Accepted 2006-SEP-12 by JYOTI. 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Parkin ubiquitinates and promotes the degradation of RanBP2. Parkin ubiquitinates and promotes the degradation of RanBP2. J. Biol. Chem. (0021-9258) 2006 imex curation Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. BioCreative - Critical Assessment of Information Extraction systems in Biology Parkinsons - Interactions investigated in the context of Parkinsons disease Synapse - Interactions of proteins with an established role in the presynapse. kchung@yonsei.ac.kr 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA Only protein-protein interactions mouse-mn9d Mus musculus MN9D neuronal cells mn9d Murine immortalized dopamine-containing neuronal mesencephalic hybrid anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. BioCreative - Critical Assessment of Information Extraction systems in Biology kchung@yonsei.ac.kr Accepted 2006-SEP-12 by JYOTI. 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Parkin ubiquitinates and promotes the degradation of RanBP2. Parkin ubiquitinates and promotes the degradation of RanBP2. J. Biol. Chem. (0021-9258) 2006 imex curation Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. BioCreative - Critical Assessment of Information Extraction systems in Biology Parkinsons - Interactions investigated in the context of Parkinsons disease Synapse - Interactions of proteins with an established role in the presynapse. kchung@yonsei.ac.kr 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. BioCreative - Critical Assessment of Information Extraction systems in Biology kchung@yonsei.ac.kr Accepted 2006-SEP-12 by JYOTI. 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Parkin ubiquitinates and promotes the degradation of RanBP2. Parkin ubiquitinates and promotes the degradation of RanBP2. J. Biol. Chem. (0021-9258) 2006 imex curation Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. BioCreative - Critical Assessment of Information Extraction systems in Biology Parkinsons - Interactions investigated in the context of Parkinsons disease Synapse - Interactions of proteins with an established role in the presynapse. kchung@yonsei.ac.kr 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. BioCreative - Critical Assessment of Information Extraction systems in Biology kchung@yonsei.ac.kr Accepted 2006-SEP-12 by JYOTI. human fetal brain cDNA J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Parkin ubiquitinates and promotes the degradation of RanBP2. Parkin ubiquitinates and promotes the degradation of RanBP2. J. Biol. Chem. (0021-9258) 2006 imex curation Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. BioCreative - Critical Assessment of Information Extraction systems in Biology Parkinsons - Interactions investigated in the context of Parkinsons disease Synapse - Interactions of proteins with an established role in the presynapse. kchung@yonsei.ac.kr 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA Only protein-protein interactions mouse-brain-cortex Mus musculus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. BioCreative - Critical Assessment of Information Extraction systems in Biology Brain cortex isolated and homogenised kchung@yonsei.ac.kr Accepted 2006-SEP-12 by JYOTI. 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Parkin ubiquitinates and promotes the degradation of RanBP2. Parkin ubiquitinates and promotes the degradation of RanBP2. J. Biol. Chem. (0021-9258) 2006 imex curation Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. BioCreative - Critical Assessment of Information Extraction systems in Biology Parkinsons - Interactions investigated in the context of Parkinsons disease Synapse - Interactions of proteins with an established role in the presynapse. kchung@yonsei.ac.kr 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. BioCreative - Critical Assessment of Information Extraction systems in Biology kchung@yonsei.ac.kr Accepted 2006-SEP-12 by JYOTI. 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Parkin ubiquitinates and promotes the degradation of RanBP2. Parkin ubiquitinates and promotes the degradation of RanBP2. J. Biol. Chem. (0021-9258) 2006 imex curation Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. BioCreative - Critical Assessment of Information Extraction systems in Biology Parkinsons - Interactions investigated in the context of Parkinsons disease Synapse - Interactions of proteins with an established role in the presynapse. kchung@yonsei.ac.kr 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA Only protein-protein interactions human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. BioCreative - Critical Assessment of Information Extraction systems in Biology kchung@yonsei.ac.kr Accepted 2006-SEP-12 by JYOTI. 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Parkin ubiquitinates and promotes the degradation of RanBP2. Parkin ubiquitinates and promotes the degradation of RanBP2. J. Biol. Chem. (0021-9258) 2006 imex curation Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. BioCreative - Critical Assessment of Information Extraction systems in Biology Parkinsons - Interactions investigated in the context of Parkinsons disease Synapse - Interactions of proteins with an established role in the presynapse. kchung@yonsei.ac.kr 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA Only protein-protein interactions human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. BioCreative - Critical Assessment of Information Extraction systems in Biology kchung@yonsei.ac.kr Accepted 2006-SEP-12 by JYOTI. 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Parkin ubiquitinates and promotes the degradation of RanBP2. Parkin ubiquitinates and promotes the degradation of RanBP2. J. Biol. Chem. (0021-9258) 2006 imex curation Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. BioCreative - Critical Assessment of Information Extraction systems in Biology Parkinsons - Interactions investigated in the context of Parkinsons disease Synapse - Interactions of proteins with an established role in the presynapse. kchung@yonsei.ac.kr 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA Only protein-protein interactions human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. BioCreative - Critical Assessment of Information Extraction systems in Biology kchung@yonsei.ac.kr Accepted 2006-SEP-12 by JYOTI. 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Parkin ubiquitinates and promotes the degradation of RanBP2. Parkin ubiquitinates and promotes the degradation of RanBP2. J. Biol. Chem. (0021-9258) 2006 imex curation Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. BioCreative - Critical Assessment of Information Extraction systems in Biology Parkinsons - Interactions investigated in the context of Parkinsons disease Synapse - Interactions of proteins with an established role in the presynapse. kchung@yonsei.ac.kr 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Um JW., Min DS., Rhim H., Kim J., Paik SR., Chung KC. BioCreative - Critical Assessment of Information Extraction systems in Biology kchung@yonsei.ac.kr Accepted 2006-SEP-12 by JYOTI. 24-JAN-2007: Contacted by JYOTI. human fetal brain cDNA J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation d4a054_rat LOC100911178 Ranbp2 protein protein rat Rattus norvegicus (Rat) Rat MRRSKAEVERYIASVQGSAPSPREKSMKGFYFAKLYYEAKEYDLAKKYISTYINVQERDPKAHRFLGLLYEIEENTDKAVECYKRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCKGEDGWNKLFDLIQSELYARPDDVHVNIRLVELYRSNKRLKDAVAHCHEADRNMALRSSLEWNSCVVQTLKEYLESLQCLDSDKSTWRATNKDLLLAYSNLMLLTLSTRDVQESRELLESFDSALQSVKSSVGGNDELSATFLETKGHFYMHVGSLLLKMGQQSDIQWRALSELAALCYLIAFQVPRPKVKLIKGETGQNLLEMMAHDRLSQSGHMLLNLSRGKQDFLKEVVESFANKSGQSALCDALFSSQSSKDRSFLGNDDIGNLDGQVPDLDDLARYDTGAVRAHSGSLQHLTWLGLQWNSLPTLPAIRKWLKQLFHHLPQETSRLETNAPESICILDLEVFLLGVIYTSHLQLREKSNSHHTSYQPLCLPLPVCRQLCTERQKSWWDAVCTLIHRKALPGTSAKLRLLVQREINSLRGQEKHGLQPALLVHWAQSLQKTGSSLNSFYDQREYIGRSVHYWRKVLPLLKMIRKKNSIPEPIDPLFKHFHSVDIQVSEIGEYEEDAHITFAILDAVNGNIEDAMTAFESIKNVVSYWNLALIFHRKAEDIENDALSPEEQEECKNYLRKTRDYLIKILDDSDSNISVVQKLPVPLESVKEMLNSVMQELEDYSEGGTLYKNGCFRSADSELKHSTPSPTKYSLSPSKSYKYSPKTPPRWAEDQNSLLKMICQQVEAIKKEMQELKLNSNNSASPHRWPAEHYRQDPVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGPVYGMNRLPPQQHIYAYSQQMHTPPVQSSSSCMFSQEMYGPPLRFESPATGILSPRGDDYFNYNVQQTSTNPPLPEPGYFTKPPLVAHASRSGESKVIEFGKSNFVQPMQGEVIRPPLATPAHTTQPTPFKFNSNFKSNDGDFTFSSPQVVTQSPSTAYSNSESLLGLLTSDKPLQGDGYSGLKPISAQTGGSRNTFSFGSKSTLTENMGPNQQKNFGFRRSDDMFTFHGPGKSIFTTPTSELANKSHETDGGSAHGDEEDDGPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRFDGESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGSDRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQNILKALGTNASTAANHTLRIVKEPATQDNKDICKSDGGNLNFEFQIVKKEGPFWNCNSCSFKNAATATKCVSCQNTKPTNGKELLGSPLVENGFASKTGPENVQDRFALMTPNKEGHWDCSVCLVRNEPTVSRCIACQNTKSANKNGSSFAQTSFKFGQGDLSKSADSDFRSVFSKKEGQWDCSICLVRNEASSTKCVACQNPAKQAPEGQWDCSLCSVRNEANAVKCVACQNPVKPSSSTTVTVLPSFKFGTSEMTKPPRSGFEGMFAKKEGQWDCSLCFVRNEASASQCIACQNPNKQNQPTSAVSAPASSETSKSPKCGFEGLFTRKEGEWECTVCSVQNESSSLKCVSCDASKPTHKPIAEAPSAFTVGSKSQLNESAGSQVGTEFKSNFPEKNFKVGISEQKFKFGHVDQEKTPSFTFQGSSNTEFKSIKDGFSFCIPVSADGFKFGIQEKGNQEKKSEKHLENDPGFQAHDTSGQKNGSGVVFGQTSSTFTFADLAKSTSREGFQFGKKDPNFKGFSGAGEKLFSSQSGKVAEKANTSDLEKDDDAYKTEDSDDIHFEPVVQMPEKVELVTGEEDEKVLYSQRVKLFRFDAEISQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSGSDRAWMWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFKTFLTNDQAKVTEEENTSSGADASSASDTTVKQNPDNTGPALEWDNYDLREDALDDSVSSSSVHASPLASSPVRKNLFRFGESTTGFNFSFKSALSPSKSPAKLNQSGTSVGTDEESDVTQEEERDGQYFEPVVPLPDLIEVSSGEENEQVVFSHRAKLYRYDKDVGQWKERGIGDIKILQNYDNKQVRIVMRRDQVLKLCANHRITPDMTLQTMKGTERVWVWTACDFADGERKIEHLAVRFKLQDVADSFKKIFDEAKTAQEKDCLITPHVSHLSTPRESPCGKIAIAVLEETTRERTDLTQGDEVVDTTSEAGETSSTSETTPKAVVSPPKFVFGSESVKSIFSSEKSKPFAFGNSSATGSLFGFSFNAPLKNSNSEISSIVQSGSEGKVDPDKGELPPNSDIKQSSDGKVKNLIAFSKETSSTFKTPEKAREKNKPEDPPSDTDILIVYELTPTPEQKALAEKLLLPSTFFCYKNRPGYVSEEEEDDEDFEMAVKKLNGKLYVDDSEKPLEENLADNDKECVIVWEKKPTVEERAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELRKVQEAQKSQSEKVTNTVGIEQTGETEATNPDGSKSEEPDSDTKHSSSSPVPGTMDKPVDLSTKKETDMEFPSQGESKTVLFGFGSGTGLSFADLASSNSGDFAFGPKDKNFQWANTGAAVFGTQSTSKDGDDEDGSDEDVVHNEDIHFEPIVSLPEVEVKSGEEDEEVLFKERAKLYRWDRDVSQWKERGIGDIKILWHSVKNYYRILMRRDQVFKVCANHVITKAMELKPLNFSNNALVWTASDYADGEAKIEQLAVRFKTKEITECFKKKIEECQQNIMKLQNGQVSLAAELSKETNPVVFFDVCVDGEPLGRIIMELFSNIVPQTAENFRALCTGEKGFGFKNSIFHRVVPDFICQGGDITKYNGTGGQSIYGDKFDDENFDLKHTGPGLLSMANCGQNTNSSQFFITLKKAEHLDFKHVVFGFVKDGMDTVRKIESFGSPKGSVSRRICITECGQL 2360D82745A4825B rbp2_mouse E3 SUMO-protein ligase RanBP2 Ran-binding protein 2 Ranbp2 protein protein mouse Mus musculus Mouse MRRSKADVERYIASVQGSAPSPREKSMKGFYFAKLYYEAKEYDLAKKYISTYINVQERDPKAHRFLGLLYEVEENIDKAVECYKRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCKGEDGWNKLFDLIQSELYARPDDIHVNIRLVELYRSNKRLKDAVAHCHEADRNTALRSSLEWNLCVVQTLKEYLESLQCLDSDKSTWRATNKDLLLAYANLMLLTLSTRDVQEGRELLESFDSALQSVKSSVGGNDELSATFLETKGHFYMHVGSLLLKMGQQSDIQWRALSELAALCYLVAFQVPRPKVKLIKGEAGQNLLETMAHDRLSQSGHMLLNLSRGKQDFLKEVVESFANKSGQSALCDALFSSQSSKERSFLGNDDIGNLDGQVPDPDDLARYDTGAVRAHNGSLQHLTWLGLQWNSLSTLPAIRKWLKQLFHHLPQETSRLETNAPESICILDLEVFLLGVIYTSHLQLKEKCNSHHTSYQPLCLPLPVCRQLCTERQKTWWDAVCTLIHRKALPGTSAKLRLLVQREINSLRGQEKHGLQPALLVHWAQSLQKTGSSLNSFYDQREYIGRSVHYWRKVLPLLKMIRKKNSIPEPIDPLFKHFHSVDIQASEIGEYEEDAHITFAILDAVNGNIEDAMTAFESIKNVVSYWNLALIFHRKAEDIENDALSPEEQEECKNYLRKTRDYLIRILDDSDSNTSVVQKLPVPLESVKEMLNSVMQELEDYSEGGTLYKNGCWRSADSELKHSTPSPTKYSLSPSKSYKYSPKTPPRWAEDQNSLLKMICQQVEAIKKEMQELKLNSNNSASPHRWPAEPYGQDPAPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGPVYGMNRLPPQQHIYAYSQQMHTPPVQSSSACMFSQEMYGPPLRFESPATGILSPRGDDYFNYNVQQTSTNPPLPEPGYFTKPPLVAHASRSAESKVIEFGKSNFVQPMQGEVIRPPLTTPAHTTQPTPFKFNSNFKSNDGDFTFSSPQVVAQPPSTAYSNSESLLGLLTSDKPLQGDGYSGLKPISGQASGSRNTFSFGSKNTLTENMGPNQQKNFGFHRSDDMFAFHGPGKSVFTTAASELANKSHETDGGSAHGDEEDDGPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRFDGESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGSDRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQNILKALGTNTSTAPNHTLRIVKESATQDNKDICKADGGNLNFEFQIVKKEGPYWNCNSCSFKNAATAKKCVSCQNTNPTSNKELLGPPLVENGFAPKTGLENAQDRFATMTANKEGHWDCSVCLVRNEPTVSRCIACQNTKSASSFVQTSFKFGQGDLPKSVDSDFRSVFSKKEGQWECSVCLVRNERSAKKCVACENPGKQFKEWHCSLCSVKNEAHAIKCVACNNPVTPSLSTAPPSFKFGTSEMSKPFRIGFEGMFAKKEGQWDCSLCFVRNEASATHCIACQYPNKQNQPTSCVSAPASSETSRSPKSGFEGLFPKKEGEWECAVCSVQNESSSLKCVACEASKPTHKPHEAPSAFTVGSKSQSNESAGSQVGTEFKSNFPEKNFKVGISEQKFKFGHVDQEKTPSFAFQGGSNTEFKSIKDGFSFCIPVSADGFKFGIQEKGNQEKKSEKHLENDPSFQAHDTSGQKNGSGVVFGQTSSTFTFADLAKSTSREGFQFGKKDPNFKGFSGAGEKLFSSQSGKVAEKANTSSDLEKDDDAYKTEDSDDIHFEPVVQMPEKVELVTGEEDEKVLYSQRVKLFRFDAEISQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSGSDRAWMWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFKTFLTNDQVKVTDEENASSGADAPSASDTTAKQNPDNTGPALEWDNYDLREDALDDSVSSSSVHASPLASSPVRKNLFRFGESTTGFNFSFKSALSPSKSPAKLNQSGASVGTDEESDVTQEEERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHRAKLYRYDKDVGQWKERGIGDIKILQNYDNKQVRIVMRRDQVLKLCANHRITPDMTLQTMKGTERVWVWTACDFADGERKIEHLAVRFKLQDVADSFKKIFDEAKTAQEKDSLITPHVSHLSTPRESPCGKIAIAVLEETTRERTDLTQGDEVIDTTSEAGETSSTSETTPKAVVSPPKFVFGSESVKSIFSSEKSKPFAFGNSSATGSLFGFSFNAPLKNSNSEMTSRVQSGSEGKVKPDKCELPQNSDIKQSSDGKVKNLSAFSKENSSTSYTFKTPEKAQEKSKPEDLPSDNDILIVYELTPTPEQKALAEKLLLPSTFFCYKNRPGYVSEEEEDDEDYEMAVKKLNGKLYLDDSEKPLEENLADNDKECVIVWEKKPTVEERAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELRKVCEAQKSQNEKVTDRVGIEHIGETEVTNPVGCKSEEPDSDTKHSSSSPVSGTMDKPVDLSTRKETDMEFPSKGENKPVLFGFGSGTGLSFADLASSNSGDFAFGSKDKNFQWANTGAAVFGTQTTSKGGEDEDGSDEDVVHNEDIHFEPIVSLPEVEVKSGEEDEEVLFKERAKLYRWDRDVSQWKERGIGDIKILWHTMKKYYRILMRRDQVFKVCANHVITKAMELKPLNVSNNALVWTASDYADGEAKVEQLAVRFKTKEMTESFKKKFEECQQNIIKLQNGHTSLAAELSKDTNPVVFFDVCADGEPLGRIIMELFSNIVPQTAENFRALCTGEKGFGFKNSIFHRVVPDFICQGGDITKYNGTGGQSIYGDKFDDENFDLKHTGPGLLSMANYGQNTNSSQFFITLKKAEHLDFKHVVFGFVKDGMDTVRKIESFGSPKGSVSRRICITECGQL 62FD4249DEE466AE prkn_human E3 ubiquitin-protein ligase parkin PRKN PARK2 Parkin RBR E3 ubiquitin-protein ligase Parkinson juvenile disease protein 2 protein protein human Homo sapiens Human MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV DIP protein O60260 original sequence version: 99 DIP protein O60260-1 original sequence version: 145 DIP protein O60260-1 original sequence version: 158 DIP protein O60260 original sequence version: 157 9A8BB802A3FC84C3 rbp2_human E3 SUMO-protein ligase RanBP2 RANBP2 NUP358 Ran-binding protein 2 Nuclear pore complex protein Nup358 Nucleoporin Nup358 358 kDa nucleoporin p270 protein protein human Homo sapiens Human MRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWLERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVEVYRSTKRLKDAVAHCHEAERNIALRSSLEWNSCVVQTLKEYLESLQCLESDKSDWRATNTDLLLAYANLMLLTLSTRDVQESRELLQSFDSALQSVKSLGGNDELSATFLEMKGHFYMHAGSLLLKMGQHSSNVQWRALSELAALCYLIAFQVPRPKIKLIKGEAGQNLLEMMACDRLSQSGHMLLNLSRGKQDFLKEIVETFANKSGQSALYDALFSSQSPKDTSFLGSDDIGNIDVREPELEDLTRYDVGAIRAHNGSLQHLTWLGLQWNSLPALPGIRKWLKQLFHHLPHETSRLETNAPESICILDLEVFLLGVVYTSHLQLKEKCNSHHSSYQPLCLPLPVCKQLCTERQKSWWDAVCTLIHRKAVPGNVAKLRLLVQHEINTLRAQEKHGLQPALLVHWAECLQKTGSGLNSFYDQREYIGRSVHYWKKVLPLLKIIKKKNSIPEPIDPLFKHFHSVDIQASEIVEYEEDAHITFAILDAVNGNIEDAVTAFESIKSVVSYWNLALIFHRKAEDIENDALSPEEQEECKNYLRKTRDYLIKIIDDSDSNLSVVKKLPVPLESVKEMLNSVMQELEDYSEGGPLYKNGSLRNADSEIKHSTPSPTRYSLSPSKSYKYSPKTPPRWAEDQNSLLKMICQQVEAIKKEMQELKLNSSNSASPHRWPTENYGPDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGPVYGMNRLPPQQHIYAYPQQMHTPPVQSSSACMFSQEMYGPPALRFESPATGILSPRGDDYFNYNVQQTSTNPPLPEPGYFTKPPIAAHASRSAESKTIEFGKTNFVQPMPGEGLRPSLPTQAHTTQPTPFKFNSNFKSNDGDFTFSSPQVVTQPPPAAYSNSESLLGLLTSDKPLQGDGYSGAKPIPGGQTIGPRNTFNFGSKNVSGISFTENMGSSQQKNSGFRRSDDMFTFHGPGKSVFGTPTLETANKNHETDGGSAHGDDDDDGPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGSDRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQSILKAPGTNVAMASNQAVRIVKEPTSHDNKDICKSDAGNLNFEFQVAKKEGSWWHCNSCSLKNASTAKKCVSCQNLNPSNKELVGPPLAETVFTPKTSPENVQDRFALVTPKKEGHWDCSICLVRNEPTVSRCIACQNTKSANKSGSSFVHQASFKFGQGDLPKPINSDFRSVFSTKEGQWDCSACLVQNEGSSTKCAACQNPRKQSLPATSIPTPASFKFGTSETSKTLKSGFEDMFAKKEGQWDCSSCLVRNEANATRCVACQNPDKPSPSTSVPAPASFKFGTSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNEASATKCIACQNPGKQNQTTSAVSTPASSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNEASATKCIACQNPGKQNQTTSAVSTPASSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNEASATKCIACQCPSKQNQTTAISTPASSEISKAPKSGFEGMFIRKGQWDCSVCCVQNESSSLKCVACDASKPTHKPIAEAPSAFTLGSEMKLHDSSGSQVGTGFKSNFSEKASKFGNTEQGFKFGHVDQENSPSFMFQGSSNTEFKSTKEGFSIPVSADGFKFGISEPGNQEKKSEKPLENGTGFQAQDISGQKNGRGVIFGQTSSTFTFADLAKSTSGEGFQFGKKDPNFKGFSGAGEKLFSSQYGKMANKANTSGDFEKDDDAYKTEDSDDIHFEPVVQMPEKVELVTGEEDEKVLYSQRVKLFRFDAEVSQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSGSDRAWMWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFKTFLTNDQTKVTEEENKGSGTGAAGASDTTIKPNPENTGPTLEWDNYDLREDALDDSVSSSSVHASPLASSPVRKNLFRFGESTTGFNFSFKSALSPSKSPAKLNQSGTSVGTDEESDVTQEEERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHRAKLYRYDKDVGQWKERGIGDIKILQNYDNKQVRIVMRRDQVLKLCANHRITPDMTLQNMKGTERVWLWTACDFADGERKVEHLAVRFKLQDVADSFKKIFDEAKTAQEKDSLITPHVSRSSTPRESPCGKIAVAVLEETTRERTDVIQGDDVADATSEVEVSSTSETTPKAVVSPPKFVFGSESVKSIFSSEKSKPFAFGNSSATGSLFGFSFNAPLKSNNSETSSVAQSGSESKVEPKKCELSKNSDIEQSSDSKVKNLFASFPTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKSISSPSVSSETMDKPVDLSTRKEIDTDSTSQGESKIVSFGFGSSTGLSFADLASSNSGDFAFGSKDKNFQWANTGAAVFGTQSVGTQSAGKVGEDEDGSDEEVVHNEDIHFEPIVSLPEVEVKSGEEDEEILFKERAKLYRWDRDVSQWKERGVGDIKILWHTMKNYYRILMRRDQVFKVCANHVITKTMELKPLNVSNNALVWTASDYADGEAKVEQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAELSKETNPVVFFDVCADGEPLGRITMELFSNIVPRTAENFRALCTGEKGFGFKNSIFHRVIPDFVCQGGDITKHDGTGGQSIYGDKFEDENFDVKHTGPGLLSMANQGQNTNNSQFVITLKKAEHLDFKHVVFGFVKDGMDTVKKIESFGSPKGSVCRRITITECGQI DIP protein P49792 original sequence version: 122 DIP protein P49792 original sequence version: 119 4CD9A3D5E77183FB prkn_rat E3 ubiquitin-protein ligase parkin Prkn Park2 Parkin RBR E3 ubiquitin-protein ligase protein protein rat Rattus norvegicus (Rat) Rat MIVFVRFNSSYGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELQNHLTVQNCDLEQQSIVHIVQRPQRKSHETNASGGDKPQSTPEGSIWEPRSLTRVDLSSHILPADSVGLAVILDTDSKSDSEAARGPEAKPTYHSFFVYCKGPCHKVQPGKLRVQCGTCRQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITNNSRSIPCIACTDVRNPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQKKVTCEGGNGLGCGFVFCRDCKEAYHEGECDSMFEASGATSQAYRVDQRAAEQARWEEASKETIKKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV E13CF170AD6D042B prkn_mouse E3 ubiquitin-protein ligase parkin Prkn Park2 Parkin RBR E3 ubiquitin-protein ligase protein protein mouse Mus musculus Mouse MIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRRSHETNASGGDEPQSTSEGSIWESRSLTRVDLSSHTLPVDSVGLAVILDTDSKRDSEAARGPVKPTYNSFFIYCKGPCHKVQPGKLRVQCGTCKQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITSNRRSIPCIACTDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCGFVFCRDCKEAYHEGDCDSLLEPSGATSQAYRVDKRAAEQARWEEASKETIKKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV DIP protein Q9WVS6 original sequence version: 126 5574A285A9A1B080 park2-ranbp2-1 4 13 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Cyclin E and beta-tubulin observed to also bind to PARKIN but exact chain designation not given in paper. After screening human fetal brain cDNA library, several previously known and novel proteins were identified to interact with Parkin, including cyclin E, -tubulin, and RanBP2 (data not shown). park2-ranbp2-2 6 13 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait physical association physical association O60260 transfection; As shown in Fig. 1A, the transfected FLAG-tagged Parkin was able to bind to endogenous RanBP2 in the HEK293 cells. 1A park2-ranbp2-3 10 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey physical association physical association O60260 transfection; When co-immunoprecipitation was performed in reverse with anti-FLAG antibodies, followed by immunoblot analysis with anti-RanBP2 IgGs, the results was the same. 1A park2-ranbp2-4 7 13 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait physical association physical association O60260 transfection; After eukaryotic expression plasmid encoding FLAG-tagged Parkin was transfected into the SH-SY5Y cells (Fig. 1B), the immunoprecipitation was performed with either anti-RanBP2 or anti-FLAG antibodies. As shown in Fig. 1B, Parkin selectively binds to endogenous RanBP2. 1 park2-ranbp2-5 8 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey physical association physical association O60260 transfection; After eukaryotic expression plasmid encoding FLAG-tagged Parkin was transfected into the SH-SY5Y cells (Fig. 1B), the immunoprecipitation was performed with either anti-RanBP2 or anti-FLAG antibodies. As shown in Fig. 1B, Parkin selectively binds to endogenous RanBP2. 1B park2-ranbp2-6 9 13 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role neutral component neutral component colocalization colocalization O60260 transfection; the co-localization of RanBP2 and GFP-Parkin was observed (Fig. 1C). 1C park2-ranbp2-7 3 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association These data indicated that Parkin directly binds to RanBP2 in vitro as well as in vivo, and the region spanning amino acid residues 78-170 appears to be important for its binding to RanBP2. 1D & 1E park2-ranbp2-8 5 12 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 1F After the rat and mouse brain cortex were isolated and homogenized, Western blot analysis revealed that significant levels of Parkin are present (Fig. 1F, left). The cell extracts were then immunoprecipitated with anti-RanBP2 antibodies, followed by the immunoblot analysis with either anti-Parkin or anti-RanBP2 antibodies. park2-ranbp2-9 5 16 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 1F After the rat and mouse brain cortex were isolated and homogenized, Western blot analysis revealed that significant levels of Parkin are present (Fig. 1F, left). The cell extracts were then immunoprecipitated with anti-RanBP2 antibodies, followed by the immunoblot analysis with either anti-Parkin or anti-RanBP2 antibodies. park2-ranbp2-10 1 11 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association 1F After the rat and mouse brain cortex were isolated and homogenized, Western blot analysis revealed that significant levels of Parkin are present (Fig. 1F, left). The cell extracts were then immunoprecipitated with anti-RanBP2 antibodies, followed by the immunoblot analysis with either anti-Parkin or anti-RanBP2 antibodies. park2-ranbp2-11 1 15 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 1F After the rat and mouse brain cortex were isolated and homogenized, Western blot analysis revealed that significant levels of Parkin are present (Fig. 1F, left). The cell extracts were then immunoprecipitated with anti-RanBP2 antibodies, followed by the immunoblot analysis with either anti-Parkin or anti-RanBP2 antibodies. park2-ranbp2-12 10 14 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-973962]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 2633-2633, sequence length 465 [EBI-973962]2633-2761 physical association physical association O60260 transfection; P49792 transfection; plasmids encoding for FLAG-tagged Parkin were co-transfected into HEK293 cells with a construct designed for the expression of GFP-tagged RanBP2 deletion mutant (IR1 + 2), spanning amino acids 2633-2761 of RanBP2, followed by immunoprecipitation with either anti-FLAG or anti-GFP antibodies, respectively. 2A park2-ranbp2-13 10 14 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-973976]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 2633-2633, sequence length 465 [EBI-973976]2633-2761 physical association physical association O60260 transfection; P49792 transfection; plasmids encoding for FLAG-tagged Parkin were co-transfected into HEK293 cells with a construct designed for the expression of GFP-tagged RanBP2 deletion mutant (IR1 + 2), spanning amino acids 2633-2761 of RanBP2, followed by immunoprecipitation with either anti-FLAG or anti-GFP antibodies, respectively. 2A park2-ranbp2-14 2 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-973999]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 2633-2633, sequence length 465 [EBI-973999]2633-2761 region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association O60260 transfection; P49792 transfection; C, where specified, dopaminergic MN9D cells were transfected with 3 �g of mammalian plasmid encoding GFP-tagged IR1 + 2 mutant of RanBP2 (IR) or co-transfected with FLAG-Parkin plus GFP-IR1 + 2 (IR+P), as indicated. The cells were immunoprecipitated with anti-FLAG antibodies, followed by immunoblot analysis with anti-GFP IgG. 2A park2-ranbp2-15 9 13 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain colocalization colocalization O60260 transfection; the co-localization of RanBP2 and GFP-Parkin was observed (Fig. 1C). 1C