IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Vaccinia virus uracil DNA glycosylase interacts with the A20 protein to form a heterodimeric processivity factor for the viral DNA polymerase. Vaccinia virus uracil DNA glycosylase interacts with the A20 protein to form a heterodimeric processivity factor for the viral DNA polymerase. J. Biol. Chem. (0021-9258) 2006 imex curation Stanitsa ES., Arps L., Traktman P. BioCreative - Critical Assessment of Information Extraction systems in Biology A coupled in vitro transcription-translation system was used in this study. ptrakt@mcw.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions chlae-bsc40 Chlorocebus aethiops Grivet bsc40 Cerae kidney epithelial cells http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm?atccNum=CRL-2761 these cells are temperature tolerant anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Stanitsa ES., Arps L., Traktman P. BioCreative - Critical Assessment of Information Extraction systems in Biology A coupled in vitro transcription-translation system was used in this study. ptrakt@mcw.edu Accepted 2006-SEP-15 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Vaccinia virus uracil DNA glycosylase interacts with the A20 protein to form a heterodimeric processivity factor for the viral DNA polymerase. Vaccinia virus uracil DNA glycosylase interacts with the A20 protein to form a heterodimeric processivity factor for the viral DNA polymerase. J. Biol. Chem. (0021-9258) 2006 imex curation Stanitsa ES., Arps L., Traktman P. BioCreative - Critical Assessment of Information Extraction systems in Biology A coupled in vitro transcription-translation system was used in this study. ptrakt@mcw.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Stanitsa ES., Arps L., Traktman P. BioCreative - Critical Assessment of Information Extraction systems in Biology A coupled in vitro transcription-translation system was used in this study. ptrakt@mcw.edu Accepted 2006-SEP-15 by ORCHARD. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Vaccinia virus uracil DNA glycosylase interacts with the A20 protein to form a heterodimeric processivity factor for the viral DNA polymerase. Vaccinia virus uracil DNA glycosylase interacts with the A20 protein to form a heterodimeric processivity factor for the viral DNA polymerase. J. Biol. Chem. (0021-9258) 2006 imex curation Stanitsa ES., Arps L., Traktman P. BioCreative - Critical Assessment of Information Extraction systems in Biology A coupled in vitro transcription-translation system was used in this study. ptrakt@mcw.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions chlae-bsc40 Chlorocebus aethiops Grivet bsc40 Cerae kidney epithelial cells http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm?atccNum=CRL-2761 these cells are temperature tolerant pull down pull down predetermined predetermined participant predetermined Stanitsa ES., Arps L., Traktman P. BioCreative - Critical Assessment of Information Extraction systems in Biology A coupled in vitro transcription-translation system was used in this study. ptrakt@mcw.edu Accepted 2006-SEP-15 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Vaccinia virus uracil DNA glycosylase interacts with the A20 protein to form a heterodimeric processivity factor for the viral DNA polymerase. Vaccinia virus uracil DNA glycosylase interacts with the A20 protein to form a heterodimeric processivity factor for the viral DNA polymerase. J. Biol. Chem. (0021-9258) 2006 imex curation Stanitsa ES., Arps L., Traktman P. BioCreative - Critical Assessment of Information Extraction systems in Biology A coupled in vitro transcription-translation system was used in this study. ptrakt@mcw.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions chlae-bsc40 Chlorocebus aethiops Grivet bsc40 Cerae kidney epithelial cells http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm?atccNum=CRL-2761 these cells are temperature tolerant anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Stanitsa ES., Arps L., Traktman P. BioCreative - Critical Assessment of Information Extraction systems in Biology A coupled in vitro transcription-translation system was used in this study. ptrakt@mcw.edu Accepted 2006-SEP-15 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation a20_vaccc DNA polymerase processivity factor component A20 A20R protein protein vaccc Vaccinia virus (strain Copenhagen) (VACV) VACV MTSSADLTNLKELLSLYKSLRFSDSAAIEKYNSLVEWGTSTYWKIGVQKVANVETSISDYYDEVKNKPFNIDPGYYIFLPVYFGSVFIYSKGKNMVELGSGNSFQIPDDMRSACNKVLDSDNGIDFLRFVLLNNRWIMEDAISKYQSPVNIFKLASEYGLNIPKYLEIEIEEDTLFDDELYSIIERSFDDKFPKISISYIKLGELRRQVVDFFKFSFMYIESIKVDRIGDNIFIPSVITKSGKKILVKDVDHLIRSKVREHTFVKVKKKNTFSILYDYDGNGTETRGEVIKRIIDTIGRDYYVNGKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE F316F8FDEC861DE3 dpol_vaccw DNA polymerase POL VACWR065 E9L protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MDVRCINWFESHGENRFLYLKSRCRNGETVFIRFPHYFYYVVTDEIYQSLSPPPFNARPLGKMRTIDIDETISYNLDIKDRKCSVADMWLIEEPKKRSIQNATMDEFLNISWFYISNGISPDGCYSLDEQYLTKINNGCYHCDDPRNCFAKKIPRFDIPRSYLFLDIECHFDKKFPSVFINPISHTSYCYIDLSGKRLLFTLINEEMLTEQEIQEAVDRGCLRIQSLMEMDYERELVLCSEIVLLRIAKQLLELTFDYVVTFNGHNFDLRYITNRLELLTGEKIIFRSPDKKEAVYLCIYERNQSSHKGVGGMANTTFHVNNNNGTIFFDLYSFIQKSEKLDSYKLDSISKNAFSCMGKVLNRGVREMTFIGDDTTDAKGKAAAFAKVLTTGNYVTVDEDIICKVIRKDIWENGFKVVLLCPTLPNDTYKLSFGKDDVDLAQMYKDYNLNIALDMARYCIHDACLCQYLWEYYGVETKTDAGASTYVLPQSMVFEYRASTVIKGPLLKLLLETKTILVRSETKQKFPYEGGKVFAPKQKMFSNNVLIFDYNSLYPNVCIFGNLSPETLVGVVVSTNRLEEEINNQLLLQKYPPPRYITVHCEPRLPNLISEIAIFDRSIEGTIPRLLRTFLAERARYKKMLKQATSSTEKAIYDSMQYTYKIVANSVYGLMGFRNSALYSYASAKSCTSIGRRMILYLESVLNGAELSNGMLRFANPLSNPFYMDDRDINPIVKTSLPIDYRFRFRSVYGDTDSVFTEIDSQDVDKSIEIAKELERLINNRVLFNNFKIEFEAVYKNLIMQSKKKYTTMKYSASSNSKSVPERINKGTSETRRDVSKFHKNMIKTYKTRLSEMLSEGRMNSNQVCIDILRSLETDLRSEFDSRSSPLELFMLSRMHHSNYKSADNPNMYLVTEYNKNNPETIELGERYYFAYICPANVPWTKKLVNIKTYETIIDRSFKLGSDQRIFYEVYFKRLTSEIVNLLDNKVLCISFFERMFGSKPTFYEA BB663635CC82446F ung_vaccc Uracil-DNA glycosylase UNG D4R protein protein vaccc Vaccinia virus (strain Copenhagen) (VACV) VACV MNSVTVSHAPYTITYHDDWEPVMSQLVEFYNEVASWLLRDETSPIPDKFFIQLKQPLRNKRVCVCGIDPYPKDGTGVPFESPNFTKKSIKEIASSISRLTGVIDYKGYNLNIIDGVIPWNYYLSCKLGETKSHAIYWDKISKLLLQHITKHVSVLYCLGKTDFSNIRAKLESPVTTIVGYHPAARDRQFEKDRSFEIINVLLELDNKVPINWAQGFIY 6A4184AFA912B97F dpol_vaccc DNA polymerase POL E9L protein protein vaccc Vaccinia virus (strain Copenhagen) (VACV) VACV MDVRCINWFESHGENRFLYLKSRCRNGETVFIRFPHYFYYVVTDEIYQSLSPPPFNARPLGKMRTIDIDETISYNLDIKDRKCSVADMWLIEEPKKRSIQNATMDEFLNISWFYISNGISPDGCYSLDEQYLTKINNGCYHCDDPRNCFAKKIPRFDIPRSYLFLDIECHFDKKFPSVFINPISHTSYCYIDLSGKRLLFTLINEEMLTEQEIQEAVDRGCLRIQSLMEMDYERELVLCSEIVLLRIAKQLLELTFDYVVTFNGHNFDLRYITNRLELLTGEKIIFRSPDKKEAVHLCIYERNQSSHKGVGGMANTTFHVNNNNGTIFFDLYSFIQKSEKLDSYKLDSISKNAFSCMGKVLNRGVREMTFIGDDTTDAKGKAAAFAKVLTTGNYVTVDEDIICKVIRKDIWENGFKVVLLCPTLPNDTYKLSFGKDDVDLAQMYKDYNLNIALDMARYCIHDACLCQYLWEYYGVETKTDAGASTYVLPQSMVFEYRASTVIKGPLLKLLLETKTILVRSETKQKFPYEGGKVFAPKQKMFSNNVLIFDYNSLYPNVCIFGNLSPETLVGVVVSTNRLEEEINNQLLLQKYPPPRYITVHCEPRLPNLISEIAIFDRSIEGTIPRLLRTFLAERARYKKMLKQATSSTEKAIYDSMQYTYKIVANSVYGLMGFRNSALYSYASAKSCTSIGRRMILYLESVLNGAELSNGMLRFANPLSNPFYMDDRDINPIVKTSLPIDYRFRFRSVYGDTDSVFTEIDSQDVDKSIEIAKELERLINNRVLFNNFKIEFEAVYKNLIMQSKKKYTTMKYSASSNSKSVPERINKGTSETRRDVSKFHKNMIKTYKTRLSEMLSEGRMNSNQVCIDILRSLETDLRSEFDSRSSPLELFMLSRMHHSNYKSADNPNMYLVTEYNKNNPETIELGERYYFAYICPANVPWTKKLVNIKTYETIIDRSFKLGSDQRIFYEVYFKRLTSEIVNLLDNKVLCISFFERMFGSKPTFYEA 9D68FE95A93AE536 ung-a20r 2 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation glu185ala arg186ala ser phe asp189ala asp190ala lys191ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:46:42 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'region' in vitro In vitro 7 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P20536:p.Asp68Asn mutation mutation certain certain sequence position certain certain certain sequence position certain D N Wed May 02 15:22:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp68asn' Tue Jun 30 17:33:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp68Asn' P20536:p.His181Leu mutation mutation certain certain sequence position certain certain certain sequence position certain H L Wed May 02 16:54:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his181leu' Tue Jun 30 18:20:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His181Leu' in vitro In vitro direct interaction direct interaction A catalytically inactive mutant of Uracil-DNA glycosylase (P20536) was used in this study. The mutant form of the A20 protein (tsA20-ER5) ( P20995) is a temperature sensetive muatant form of the protein Figure 3 The fUDG-A20 interaction is preserved in vitro and does not require catalytically active UDG. The details of tsA20-ER5 mutant were obtained from PMID: 11711621 ung-a20r-1 1 7 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Figure 4C Vaccinia virus UDG protein is an early protein that interacts with A20 in vivo. a20r-ung 4 5 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 4C Vaccinia virus UDG protein is an early protein that interacts with A20 in vivo. ung-a20r-2 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Figure 5A to 5C Purification of stable complexes f fUDG-A20 and fUDG-A20-Pol. Proteins were identified by silver staining after SDS PAGE. E9 DNA polymerase (P06856) was not coprecipitated when A20 protein (P20995) was not present. The complex was judged to be extremely stable as washes of up to 750mM NaCL did not remove bound protein (A20) from the column. ung-a20r-3 3 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Figure 5A to 5C Purification of stable complexes f fUDG-A20 and fUDG-A20-Pol. Proteins were identified by silver staining after SDS PAGE. ung-a20r-4 3 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 5A to 5C Purification of stable complexes f fUDG-A20 and fUDG-A20-Pol. Proteins were identified by silver staining after SDS PAGE.