IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structure of the N-terminal calcium sensor domain of centrin reveals the biochemical basis for domain-specific function. Structure of the N-terminal calcium sensor domain of centrin reveals the biochemical basis for domain-specific function. J. Biol. Chem. (0021-9258) 2006 imex curation Sheehan JH., Bunick CG., Hu H., Fagan PA., Meyn SM., Chazin WJ. BioCreative - Critical Assessment of Information Extraction systems in Biology All NMR data were recorded at 25 C on Bruker DRX600 and DRX800 spectrometers equipped with triple-resonance probe heads and triple axis pulsed field gradient accessories. walter.chazin@vanderbilt.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Sheehan JH., Bunick CG., Hu H., Fagan PA., Meyn SM., Chazin WJ. BioCreative - Critical Assessment of Information Extraction systems in Biology All NMR data were recorded at 25 C on Bruker DRX600 and DRX800 spectrometers equipped with triple-resonance probe heads and triple axis pulsed field gradient accessories. walter.chazin@vanderbilt.edu Accepted 2006-SEP-11 by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Structure of the N-terminal calcium sensor domain of centrin reveals the biochemical basis for domain-specific function. Structure of the N-terminal calcium sensor domain of centrin reveals the biochemical basis for domain-specific function. J. Biol. Chem. (0021-9258) 2006 imex curation Sheehan JH., Bunick CG., Hu H., Fagan PA., Meyn SM., Chazin WJ. BioCreative - Critical Assessment of Information Extraction systems in Biology All NMR data were recorded at 25 C on Bruker DRX600 and DRX800 spectrometers equipped with triple-resonance probe heads and triple axis pulsed field gradient accessories. walter.chazin@vanderbilt.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Sheehan JH., Bunick CG., Hu H., Fagan PA., Meyn SM., Chazin WJ. BioCreative - Critical Assessment of Information Extraction systems in Biology All NMR data were recorded at 25 C on Bruker DRX600 and DRX800 spectrometers equipped with triple-resonance probe heads and triple axis pulsed field gradient accessories. walter.chazin@vanderbilt.edu Accepted 2006-SEP-11 by JYOTI. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation catr_chlre Caltractin Centrin 20 kDa calcium-binding protein protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MSYKAKTVVSARRDQKKGRVGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKMGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMKKTSLF 731D171794EAD983 o12369_9viru Nucleoprotein protein protein laguna negra orthohantavirus laguna negra orthohantavirus MSNLQEVQEGITLHEQQLVAARQKLKDAEKAVEVDPDDVNKSTLQSRRAAVSALENKLAELKRQLADLVAAQKLAAKPVDPTGLEPDDHLKEKSALRYGNVLDVNAIDLEEPSGQTADWKAIGAYILGFVIPIILKALYMLSTRGRQTVKENKGTRIRFKDDSSFEEVNGIRKPKHLYVSMPTAQSTMKADEITPGRFRTIACGLFPAQIKARNIISPVMGVIGFGHFVKDWMERIDNFLGEDCPFLPKARVQSEAFMSTNRAYFLNRQRQVDESRIQDIVDLIQAAEASSATLFNDIATPHSAWVFACAPDRCPPTALYVAGVPELGAFFAILQDMRNTIMASKSVGTAEEKLKKKSAFYQSYLRRTQSMGIQLDQKIIILYMLSWGKEAVNHFHLGDDMDPELRQLAQTLIDAKVKEISNQEPLKL C46FB5B5D8A7B802 crc_n-sfi1 1 3 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-983763]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 450-450, sequence length 428 [EBI-983763]450-473 direct interaction direct interaction Figure 2B To further test the ability of CRC-N to serve as a calcium sensor, experiments were performed to characterize CRC-N binding of a peptide fragment of Sfi1 corresponding to the seventh centrin binding repeat. Peturbations in the NMR signal were only found in the presence of calcium (5-10 mM) indicating interaction was dependent on calcium. The authors note that "The observation of perturbations of only a subset of CRC-N signals indicates that the peptide binds to a discrete binding site on the protein." The widespread distribution of chemical shift perturbations suggests that the conformation of protein changes in concert with binding of the peptide and limits the ability to define the binding site. crc_n-sfi1-1 2 3 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1002062]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 450-450, sequence length 428 [EBI-1002062]450-473 direct interaction direct interaction Figure 2A Binding of Sfi1 peptide to CRC-N.